KEGG   Mus musculus (mouse): 11829Help
Entry
11829             CDS       T01002                                 

Gene name
Aqp4, WCH4
Definition
(RefSeq) aquaporin 4
  KO
K09866  
aquaporin-4
Organism
mmu  Mus musculus (mouse)
Pathway
Vasopressin-regulated water reabsorption
Bile secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Digestive system
   04976 Bile secretion
    11829 (Aqp4)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    11829 (Aqp4)
Transporters [BR:mmu02000]
 Other Transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    11829 (Aqp4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
18 A1; 18 8.74 cM
AA seq 323 aa AA seqDB search
MSDRAAARRWGKCGHSCSRESIMVAFKGVWTQAFWKAVSAEFLATLIFVLLGVGSTINWG
GSENPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYII
AQCLGAIIGAGILYLVTPPSVVGGLGVTTVHGNLTAGHGLLVELIITFQLVFTIFASCDS
KRTDVTGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGNWANHWIYWVGPIMG
AVLAGALYEYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVH
VIDIDRGEEKKGKDSSGEVLSSV
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacagagctgcggcaaggcggtggggtaagtgtggacattcctgcagtagagag
agcatcatggtggctttcaaaggagtctggactcaggctttctggaaggcagtctcagca
gaatttctggccacgcttatctttgttttgctcggtgtgggatccaccataaactggggt
ggctcagaaaaccccttacctgtggacatggtcctcatctccctttgctttggactcagc
attgctaccatggtgcagtgctttggccacatcagtggtggccacatcaatcccgctgtg
actgtagccatggtgtgcacacgaaagatcagcatcgctaagtccgtcttctacatcatt
gcacagtgcctgggggccatcattggagccggcatcctctacctggtcacacctcccagt
gtggttggaggattgggagtcaccacggttcatggaaacctcaccgctggccatgggctc
ctggtggagttaataatcactttccagttggtgttcactatttttgccagctgtgattcc
aaacgaactgatgttactggttcaatagctttagcaattggattttccgttgcaattgga
catttgtttgcaatcaattatactggagccagcatgaatccagctcgatcttttggaccc
gcagttatcatgggaaactgggcaaaccactggatatattgggttggaccaatcatgggc
gctgtgctggcaggtgccctttatgagtatgtcttctgtcctgatgtggagctcaaacgt
cgccttaaggaagccttcagcaaagccgcgcagcagacaaaagggagctacatggaggtg
gaggacaaccggagccaagtggagacggaagacttgatcctgaagcccggagtggtgcat
gtgattgacattgaccgtggagaagagaagaaggggaaagactcttcgggagaggtattg
tcttccgtatga

DBGET integrated database retrieval system