KEGG   Mus musculus (mouse): 11835Help
Entry
11835             CDS       T01002                                 

Gene name
Ar, AW320017, Tfm
Definition
(RefSeq) androgen receptor
  KO
K08557  
androgen receptor
Organism
mmu  Mus musculus (mouse)
Pathway
Oocyte meiosis
Pathways in cancer
Prostate cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    11835 (Ar)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    11835 (Ar)
   05215 Prostate cancer
    11835 (Ar)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Cys4 estrogen-like
    11835 (Ar)
Nuclear receptors [BR:mmu03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   11835 (Ar)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
X C3; X 42.82 cM
AA seq 899 aa AA seqDB search
MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREAIQNPGPRHPEAANIAPPGACLQQRQET
SPRRRRRQQHTEDGSPQAHIRGPTGYLALEEEQQPSQQQAASEGHPESSCLPEPGAATAP
GKGLPQQPPAPPDQDDSAAPSTLSLLGPTFPGLSSCSADIKDILNEAGTMQLLQQQQQQQ
QHQQQHQQHQQQQEVISEGSSARAREATGAPSSSKDSYLGGNSTISDSAKELCKAVSVSM
GLGVEALEHLSPGEQLRGDCMYASLLGGPPAVRPTPCAPLPECKGLPLDEGPGKSTEETA
EYSSFKGGYAKGLEGESLGCSGSSEAGSSGTLEIPSSLSLYKSGALDEAAAYQNRDYYNF
PLALSGPPHPPPPTHPHARIKLENPLDYGSAWAAAAAQCRYGDLGSLHGGSVAGPSTGSP
PATTSSSWHTLFTAEEGQLYGPGGGGGSSSPSDAGPVAPYGYTRPPQGLTSQESDYSASE
VWYPGGVVNRVPYPSPNCVKSEMGPWMENYSGPYGDMRLDSTRDHVLPIDYYFPPQKTCL
ICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCY
EAGMTLGARKLKKLGNLKLQEEGENSNAGSPTEDPSQKMTVSHIEGYECQPIFLNVLEAI
EPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYS
WMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQIT
PQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLT
KLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgcagttagggctgggaagggtctacccacggcccccatccaagacctatcga
ggagcgttccagaatctgttccagagcgtgcgcgaagcgatccagaacccgggccccagg
caccctgaggccgctaacatagcacctcccggcgcctgtttacagcagaggcaggagact
agcccccggcggcggcggcggcagcagcacactgaggatggttctcctcaagcccacatc
agaggccccacaggctacctggccctggaggaggaacagcagccttcacagcagcaggca
gcctccgagggccaccctgagagcagctgcctccccgagcctggggcggccaccgctcct
ggcaaggggctgccgcagcagccaccagctcctccagatcaggatgactcagctgcccca
tccacgttgtccctgctgggccccactttcccaggcttaagcagctgctccgccgacatt
aaagacattttgaacgaggccggcaccatgcaacttcttcagcagcagcaacaacagcag
cagcaccaacagcagcaccaacagcaccaacagcagcaggaggtaatctccgaaggcagc
agcgcaagagccagggaggccacgggggctccctcttcctccaaggatagttacctaggg
ggcaattcaaccatatctgacagtgccaaggagttgtgtaaagcagtgtctgtgtccatg
ggattgggtgtggaagcattggaacatctgagtccaggggaacagcttcggggagactgc
atgtacgcgtcgctcctgggaggtccacccgcggtgcgtcccactccttgtgcgccgctg
cccgaatgcaaaggtcttcccctggacgaaggcccaggcaaaagcactgaagagactgct
gagtattcctctttcaagggaggttacgccaaaggattggaaggtgagagcttggggtgc
tctggcagcagtgaagcaggtagctctgggacacttgagatcccgtcctctctgtctctg
tataaatctggagcactagacgaggcagcagcataccagaatcgcgactactacaacttt
ccgctggctctgtccgggccgccgcaccccccgccccctacccatccacacgcccgtatc
aagctggagaacccattggactacggcagcgcctgggctgcggcggcagcgcaatgccgc
tatggggacttgggtagtctacatggagggagtgtagccgggcccagcactggatcgccc
ccagccaccacctcttcttcctggcatactctcttcacagctgaagaaggccaattatat
gggccaggaggcgggggcggcagcagcagcccaagcgatgccgggcctgtagccccctat
ggctacactcggccccctcaggggctgacaagccaggagagtgactactctgcctccgaa
gtgtggtatcctggtggagttgtgaacagagtaccctatcccagtcccaattgtgtcaaa
agtgaaatgggaccttggatggagaactactccggaccttatggggacatgcgtttggac
agtaccagggaccatgttttacccatcgactattactttccaccccagaagacctgcctg
atctgtggagatgaagcttctggctgtcactacggagctctcacttgtggcagctgcaag
gtcttcttcaaaagagccgctgaagggaaacagaagtatctatgtgccagcagaaacgat
tgtaccattgataaatttcggaggaaaaattgcccatcttgtcgtctccggaaatgttat
gaagcagggatgactctgggagctcgtaagctgaagaaacttggaaatctaaaactacag
gaggaaggagaaaactccaatgctggcagccccactgaggacccatcccagaagatgact
gtatcacacattgaaggctatgaatgtcagcctatctttcttaacgtcctggaagccatt
gagccaggagtggtgtgtgccggacatgacaacaaccaaccagattcctttgctgccttg
ttatctagcctcaatgagcttggagagaggcagcttgtgcatgtggtcaagtgggccaag
gccttgcctggcttccgcaacttgcatgtggatgaccagatggcggtcattcagtattcc
tggatgggactgatggtatttgccatgggttggcggtccttcactaatgtcaactccagg
atgctctactttgcacctgacttggttttcaatgagtaccgcatgcacaagtctcggatg
tacagccagtgtgtgaggatgaggcacctgtctcaagagtttggatggctccaaataacc
ccccaggaattcctgtgcatgaaagcactgctgctcttcagcattattccagtggatggg
ctgaaaaatcaaaaattctttgatgaacttcgaatgaactacatcaaggaactcgatcgc
atcattgcatgcaaaagaaagaatcccacatcctgctcaaggcgcttctaccagctcacc
aagctcctggattctgtgcagcctattgcaagagagctgcatcagttcacttttgacctg
ctaatcaagtcccatatggtgagcgtggactttcctgaaatgatggcagagatcatctct
gtgcaagtgcccaagatcctttctgggaaagtcaagcccatctatttccacacacagtga

DBGET integrated database retrieval system