KEGG   Mus musculus (mouse): 11836Help
Entry
11836             CDS       T01002                                 

Gene name
Araf, 1200013E08Rik, A-Raf, AW495444, Araf1
Definition
(RefSeq) Araf proto-oncogene, serine/threonine kinase (EC:2.7.11.1)
  KO
K08845  
A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
EGFR tyrosine kinase inhibitor resistance
Endocrine resistance
ErbB signaling pathway
FoxO signaling pathway
Vascular smooth muscle contraction
Natural killer cell mediated cytotoxicity
Long-term potentiation
Serotonergic synapse
Long-term depression
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Alcoholism
Hepatitis C
Pathways in cancer
Proteoglycans in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Melanoma
Bladder cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Non-small cell lung cancer
Module
MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    11836 (Araf)
   04068 FoxO signaling pathway
    11836 (Araf)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    11836 (Araf)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    11836 (Araf)
  Endocrine system
   04910 Insulin signaling pathway
    11836 (Araf)
   04914 Progesterone-mediated oocyte maturation
    11836 (Araf)
  Circulatory system
   04270 Vascular smooth muscle contraction
    11836 (Araf)
  Nervous system
   04726 Serotonergic synapse
    11836 (Araf)
   04720 Long-term potentiation
    11836 (Araf)
   04730 Long-term depression
    11836 (Araf)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    11836 (Araf)
   05205 Proteoglycans in cancer
    11836 (Araf)
   05210 Colorectal cancer
    11836 (Araf)
   05212 Pancreatic cancer
    11836 (Araf)
   05214 Glioma
    11836 (Araf)
   05221 Acute myeloid leukemia
    11836 (Araf)
   05220 Chronic myeloid leukemia
    11836 (Araf)
   05218 Melanoma
    11836 (Araf)
   05211 Renal cell carcinoma
    11836 (Araf)
   05219 Bladder cancer
    11836 (Araf)
   05215 Prostate cancer
    11836 (Araf)
   05213 Endometrial cancer
    11836 (Araf)
   05223 Non-small cell lung cancer
    11836 (Araf)
  Substance dependence
   05034 Alcoholism
    11836 (Araf)
  Infectious diseases
   05160 Hepatitis C
    11836 (Araf)
  Antineoplastic resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    11836 (Araf)
   01522 Endocrine resistance
    11836 (Araf)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     11836 (Araf)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: TKL group
  RAF family [OT]
   11836 (Araf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
X 16.3 cM; X A2-A3.1
AA seq 604 aa AA seqDB search
MEPPRGPPVSGAEPSRAVGTVKVYLPNKQRTVVTVREGMSVYDSLDKALKVRGLNQDCCV
VYRLIKGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHNFVRKTFFSLAFCDFCLKFLF
HGFRCQTCGYKFHQHCSSKVPTVCVDMSTNRRQFYHSIQDLSGGSRQQEAPSNLSVNELL
TPQGPSPFTQQRDQEHFSFPAPANPPLQRIRSTSTPNVHMVSTTAPMDSSLMQFTAQSFS
TDAAGRGGDGAPRGSPSPASVSSGRKSPHSKLPSEQRERKSLADEKKKVKNLGYRDSGYY
WEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVAQPTAEQAQAFKNEMQVLRKTR
HVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVARQTAQGMDYLHA
KNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAAEVIRMQD
PNPYSFQSDVYAYGVVLYELMTGSLPYSHIGSRDQIIFMVGRGYLSPDLSKIFSNCPKAM
RRLLTDCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADELPACLLSAA
RLVP
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggaaccaccacgaggccctcctgttagtggggctgagccatctcgggcagttggcact
gtcaaagtgtacctgcctaacaagcaacgcacagtggtgactgtccgggaaggcatgagt
gtctatgactctttggacaaggccctgaaggtgcggggtctcaaccaggactgctgtgtg
gtctacaggctcatcaaaggaagaaagacagtcactgcctgggacacagccattgcgcct
ctggatggtgaggagctcattgtggaggtcctagaagatgtgccactgaccatgcacaat
tttgtacggaagacattcttcagcctggccttctgtgacttctgccttaagtttctgttc
catggattccgctgccagacctgtggctacaagttccaccagcattgttcctccaaggtc
cccaccgtctgcgttgacatgagtaccaaccgccgacagttctaccacagcatccaggat
ctgtctggaggctccaggcagcaggaggctccctcaaatctctctgtgaatgagctgcta
accccccagggtcccagcccctttacccagcaacgtgaccaggagcacttctcattccct
gcccctgccaatcccccactgcagcgcatccgctccacatctactcctaacgtccacatg
gtcagcaccacagctcccatggactccagcctcatgcagtttactgctcagagcttcagc
accgatgctgctggtagaggtggtgatggagcccctcggggtagccctagcccagctagt
gtgtcttcagggaggaagtccccacattccaagttaccttcagaacagcgggagcggaag
tccttggcagatgaaaagaaaaaagtgaagaacctggggtaccgggactcaggctattac
tgggaggtgccacccagtgaggtacagctgttgaagaggatcgggacaggctcttttggc
actgtgtttcgggggcgttggcatggcgatgtagctgtgaaagtgctcaaggtggcccaa
cctaccgctgagcaggcccaggccttcaagaatgagatgcaggtgctcaggaagacacgg
catgtcaacattttgctgttcatgggtttcatgactcggccggggtttgccatcatcaca
cagtggtgtgagggttccagcctctaccaccacctacatgtggctgacacgcgctttgac
atggtccagctcattgatgtggcccggcagactgcccagggcatggactacctccacgcc
aagaacatcattcatcgagacctaaagtccaacaatatcttcttacatgaggggctcaca
gtcaagattggtgacttcggcctggccacagtgaagacacggtggagtggggcacagccc
ttagagcagccctcagggtctgtgctatggatggcagctgaggtgatccgtatgcaggac
ccgaacccctacagcttccagtcggatgtctatgcctatggtgttgtgctctatgagctc
atgaccggctcactgccctacagccacattggcagccgtgaccagatcatctttatggtg
ggccgtggctatctgtctccggacctcagcaaaatcttcagtaattgccccaaagccatg
aggcgcctgctgactgactgcctcaagttccagcgggaggagcggcccctatttccccag
attctggccacgatcgagctactgcagcggtcactccccaagattgagcggagtgcctcc
gaaccctccttgcaccgcacccaggctgatgagttgcctgcttgccttctcagcgcagcc
cgtcttgtgccttag

DBGET integrated database retrieval system