KEGG   Mus musculus (mouse): 11846Help
Entry
11846             CDS       T01002                                 

Gene name
Arg1, AI, AI256583, Arg-1, PGIF
Definition
arginase, liver (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Amoebiasis
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    11846 (Arg1)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    11846 (Arg1)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    11846 (Arg1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     11846 (Arg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
10 A4; 10
AA seq 323 aa AA seqDB search
MSSKPKSLEIIGAPFSKGQPRGGVEKGPAALRKAGLLEKLKETEYDVRDHGDLAFVDVPN
DSSFQIVKNPRSVGKANEELAGVVAEVQKNGRVSVVLGGDHSLAVGSISGHARVHPDLCV
IWVDAHTDINTPLTTSSGNLHGQPVSFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLR
DVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPAF
TPATGTPVLGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTAEEVKSTVNTAVALT
LACFGTQREGNHKPGTDYLKPPK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagctccaagccaaagtccttagagattatcggagcgcctttctcaaaaggacagcct
cgaggaggggtagagaaaggccctgcagcactgaggaaagctggtctgctggaaaaactt
aaagaaacagagtatgacgtgagagaccacggggacctggcctttgttgatgtccctaat
gacagctcctttcaaattgtgaagaacccacggtctgtggggaaagccaatgaagagctg
gctggtgtggtggcagaggtccagaagaatggaagagtcagtgtggtgctgggtggagac
cacagtctggcagttggaagcatctctggccacgccagggtccaccctgacctatgtgtc
atttgggtggatgctcacactgacatcaacactcccctgacaaccagctctgggaatctg
catgggcaacctgtgtcctttctcctgaaggaactgaaaggaaagttcccagatgtacca
ggattctcctgggtgactccctgcatatctgccaaagacatcgtgtacattggcttgcga
gacgtagaccctggggaacactatataataaaaactctgggaattaagtatttctccatg
actgaagtagacaagctggggattggcaaggtgatggaagagaccttcagctacctgctg
ggaaggaagaaaaggccgattcacctgagctttgatgtcgacgggctggacccagcattc
accccggcgaccggcaccccggttctgggaggcctatcttacagagaaggtctctacatc
acagaagaaatttacaagacagggctcctttcaggactagatatcatggaagtgaaccca
actcttgggaagacagcagaggaggtgaagagtactgtgaacacggcagtggctttaacc
ttggcttgcttcggaactcaacgggagggtaaccataagccagggactgactaccttaaa
ccacctaagtga

DBGET integrated database retrieval system