KEGG   Mus musculus (mouse): 11846Help
Entry
11846             CDS       T01002                                 

Gene name
Arg1, AI, AI256583, Arg-1, PGIF
Definition
(RefSeq) arginase, liver (EC:3.5.3.1)
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of antibiotics
Biosynthesis of amino acids
Amoebiasis
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    11846 (Arg1)
  Amino acid metabolism
   00220 Arginine biosynthesis
    11846 (Arg1)
   00330 Arginine and proline metabolism
    11846 (Arg1)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    11846 (Arg1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     11846 (Arg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
10; 10 A4
AA seq 323 aa AA seqDB search
MSSKPKSLEIIGAPFSKGQPRGGVEKGPAALRKAGLLEKLKETEYDVRDHGDLAFVDVPN
DSSFQIVKNPRSVGKANEELAGVVAEVQKNGRVSVVLGGDHSLAVGSISGHARVHPDLCV
IWVDAHTDINTPLTTSSGNLHGQPVSFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLR
DVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPAF
TPATGTPVLGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTAEEVKSTVNTAVALT
LACFGTQREGNHKPGTDYLKPPK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagctccaagccaaagtccttagagattatcggagcgcctttctcaaaaggacagcct
cgaggaggggtagagaaaggccctgcagcactgaggaaagctggtctgctggaaaaactt
aaagaaacagagtatgacgtgagagaccacggggacctggcctttgttgatgtccctaat
gacagctcctttcaaattgtgaagaacccacggtctgtggggaaagccaatgaagagctg
gctggtgtggtggcagaggtccagaagaatggaagagtcagtgtggtgctgggtggagac
cacagtctggcagttggaagcatctctggccacgccagggtccaccctgacctatgtgtc
atttgggtggatgctcacactgacatcaacactcccctgacaaccagctctgggaatctg
catgggcaacctgtgtcctttctcctgaaggaactgaaaggaaagttcccagatgtacca
ggattctcctgggtgactccctgcatatctgccaaagacatcgtgtacattggcttgcga
gacgtagaccctggggaacactatataataaaaactctgggaattaagtatttctccatg
actgaagtagacaagctggggattggcaaggtgatggaagagaccttcagctacctgctg
ggaaggaagaaaaggccgattcacctgagctttgatgtcgacgggctggacccagcattc
accccggcgaccggcaccccggttctgggaggcctatcttacagagaaggtctctacatc
acagaagaaatttacaagacagggctcctttcaggactagatatcatggaagtgaaccca
actcttgggaagacagcagaggaggtgaagagtactgtgaacacggcagtggctttaacc
ttggcttgcttcggaactcaacgggagggtaaccataagccagggactgactaccttaaa
ccacctaagtga

DBGET integrated database retrieval system