KEGG   Mus musculus (mouse): 11847Help
Entry
11847             CDS       T01002                                 

Gene name
Arg2, AII, AU022422
Definition
(RefSeq) arginase type II (EC:3.5.3.1)
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of antibiotics
Biosynthesis of amino acids
Amoebiasis
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    11847 (Arg2)
  Amino acid metabolism
   00220 Arginine biosynthesis
    11847 (Arg2)
   00330 Arginine and proline metabolism
    11847 (Arg2)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    11847 (Arg2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     11847 (Arg2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
12; 12 C3
AA seq 354 aa AA seqDB search
MFLRSSASRLLHGQIPCVLTRSVHSVAIVGAPFSRGQKKLGVEYGPAAIREAGLLKRLSR
LGCHLKDFGDLSFTNVPQDDPYNNLVVYPRSVGLANQELAEVVSRAVSGGYSCVTMGGDH
SLAIGTIIGHARHRPDLCVIWVDAHADINTPLTTVSGNIHGQPLSFLIKELQDKVPQLPG
FSWIKPCLSPPNIVYIGLRDVEPPEHFILKNYDIQYFSMREIDRLGIQKVMEQTFDRLIG
KRQRPIHLSFDIDAFDPKLAPATGTPVVGGLTYREGVYITEEIHNTGLLSALDLVEVNPH
LATSEEEAKATARLAVDVIASSFGQTREGGHIVYDHLPTPSSPHESENEECVRI
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgaggagcagcgcctcccgtctcctccacgggcaaattccttgcgtcctgacg
agatccgtccactctgtagctatagtcggagcccctttctctcggggacagaagaagcta
ggagtggaatatggtccagctgccattcgagaagctggcttgctgaagaggctctccagg
ttgggatgccacctaaaagactttggagacttgagttttactaatgtcccacaagatgat
ccctacaataatctggttgtgtatcctcgttcagtgggccttgccaaccaggaactggct
gaagtggttagtagagctgtgtcaggtggctacagctgtgtcaccatgggaggagaccac
agcctggcaataggtaccattatcggtcacgcccggcaccgcccagatctctgtgtcatc
tgggttgatgctcatgcggacattaatacacctctcaccactgtatctggaaatatacat
ggacagccactttcctttctcatcaaagaactacaagacaaggtaccacaactgccagga
ttttcctggatcaaaccttgcctctctcccccaaatattgtgtacattggcctgagagat
gtggagcctcctgaacattttattttaaagaattatgacatccagtatttttccatgaga
gagattgatcgacttgggatccagaaggtgatggaacagacatttgatcggctgattggc
aaaaggcagaggccaatccacctgagttttgacattgatgcatttgaccctaaactggct
ccagccacaggaacccctgttgtagggggattaacctacagagaaggagtgtatattact
gaagaaatacataatacagggttgctgtcagctctggatcttgttgaagtcaatcctcat
ttggccacttctgaggaagaggccaaggcaacagccagactagcagtggatgtgattgct
tcaagttttggtcagacaagagaaggaggacacattgtctatgaccaccttcctactcct
agttcaccacacgaatcagaaaatgaagaatgtgtgagaatttag

DBGET integrated database retrieval system