KEGG   Mus musculus (mouse): 11870Help
Entry
11870             CDS       T01002                                 

Gene name
Art1, ADPRT, ARTC1, Yac-1
Definition
ADP-ribosyltransferase 1 (EC:2.4.2.31)
Orthology
K06716  
ADP-ribosyltransferase 1 [EC:2.4.2.31]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     11870 (Art1)
Cellular antigens [BR:mmu04090]
 Proteins
  11870 (Art1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
7 E3; 7 54.71 cM
AA seq 325 aa AA seqDB search
MKIPAMMSLLLVSVGLRDGVQVQSYSISQLDIFSQETPLDMAPASFDDQYAGCLADMTAA
LPDLNHSEFQANKVYADGWAQANNQWQERRAWGSVWGSLPPSPPGFRDEHGVALLAYTAN
SPLHKEFNAAVREAGRSRAHYLHHFSFKTLHFLLTEALQLLRSHRSRGCQQVYRGVHGLR
FRPAGPGATVRLGGFASASLKNVAAQQFGEDTFFGIWTCLGAPIRGYSFFPEEEEVLIPP
FETFQVINTSRPTQGPARIYLRALGKRSTYNCEYIKEKKCRSGPCWLGSSAPGSISASCS
LLLLLLFLVLSALPENPGLQQLTRC
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcctgctatgatgtctctcctactggtgtctgtgggtctcagggatggagtt
caggttcaaagttactccatctcacaactagacatcttttctcaagaaacacccctggac
atggccccagcgtcctttgatgaccagtatgctggctgcctggcagacatgacagcggcc
ctgccagatctcaaccactcagagtttcaggccaacaaagtatacgcggatggctgggct
caggccaacaatcagtggcaggagcgcagggcctgggggtccgtgtggggctccttgccc
ccatcaccgccgggcttccgggatgagcacggggtggcgctgctggcctacaccgccaac
agccccctgcacaaggagttcaacgcagctgtgcgtgaggcgggacgttctcgggcccat
tacctccaccacttctccttcaagaccctccacttcctgctcaccgaggccctgcaactg
ctccggagccaccgatctcgcgggtgccagcaggtgtacaggggggtgcacggcctgcgc
tttcggccagcggggcctggcgccaccgttaggctggggggctttgcttctgcgtccctc
aagaacgttgccgcccaacaatttggcgaggacaccttcttcggtatctggacctgcctt
ggggcccccatcaggggctactcctttttccctgaagaggaggaggtgctgatccctcct
ttcgaaactttccaggtgatcaatacaagccgacccacccagggtcccgcacgcatctac
ctccgcgctctgggcaaacgcagtacatacaactgtgaatacatcaaagaaaagaagtgc
aggtctgggccctgctggctgggtagctcagccccaggctccatttctgcttcctgctct
cttctgctgctgctcttgttccttgtgctgagcgcccttccagagaatccaggtctccag
caacttacccgatgttga

DBGET integrated database retrieval system