KEGG   Mus musculus (mouse): 11871Help
Entry
11871             CDS       T01002                                 

Gene name
Art2a-ps, ARTC2, Art2a, Ly92a, Rt-6, Rt6, Rt6-1
Definition
(RefSeq) ADP-ribosyltransferase 2a, pseudogene (EC:2.4.2.31 3.2.2.5)
  KO
K19980  
ADP-ribosyltransferase 2 / NAD+ glycohydrolase [EC:2.4.2.31 3.2.2.5]
Organism
mmu  Mus musculus (mouse)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    11871 (Art2a-ps)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     11871 (Art2a-ps)
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.5  NAD+ glycohydrolase
     11871 (Art2a-ps)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Enzymes
  11871 (Art2a-ps)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 E3; 7 54.6 cM
AA seq 287 aa AA seqDB search
MPSNNFKFFLTWWLTQQVTGLAVPFMLDMAPNAFDDQYEGCVEDMEKKAPQLLQEDFNMN
EELKLEWEKAEIKWKEIKNCMSYPAGFHDFHGTALVAYTGNIHRSLNEATREFKINPGNF
HYKAFHYYLTRALQLLSDQGCRSVYRGTNVRFRYTGKGSVRFGHFASSSLNRSVATSSPF
FNGQGTLFIIKTCLGAHIKHCSYYTHEEEVLIPGYEVFHKVKTQSVERYIQISLDSPKRK
KSNFNCFYSGSTQAANVSSLGSRESCVPLFLVVLLGLLVQQLTLAEP
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgccatcaaataatttcaagttcttcctaacttggtggctaacccagcaggtgactggc
cttgcagtgcctttcatgctagacatggctccaaatgcatttgatgatcagtatgagggc
tgtgtcgaagacatggagaaaaaggcaccccagctgttacaagaagacttcaacatgaat
gaggaattaaaacttgagtgggaaaaagcagagataaaatggaaggagatcaaaaattgt
atgagttatccggcaggtttccatgatttccatggaacagctttagttgcctacactggg
aacatccacagaagccttaatgaggctactagagagttcaaaataaatcctggtaacttc
cactacaaggccttccattactacttaacaagagctcttcagcttttgagtgaccagggt
tgtcgttcagtttaccgaggtactaatgtcaggtttcgttacactgggaagggctctgtg
cgatttgggcatttcgcatcctcttctttaaaccggagtgtagctacttctagtccattt
ttcaatggacaggggacattatttatcatcaaaacctgcttgggggctcacatcaaacat
tgttcctactatactcatgaagaggaggtgttaattccaggctatgaagtatttcacaaa
gtcaaaacacaaagtgtcgaacggtatatccaaatttctctggactccccaaaaaggaag
aagagcaactttaattgcttctatagcggttctactcaagcagccaacgttagcagctta
ggatctagagagagctgtgtacccctgttccttgtggttctcctcggtcttctggtccag
cagcttactcttgctgagccgtag

DBGET integrated database retrieval system