KEGG   Mus musculus (mouse): 11872Help
Entry
11872             CDS       T01002                                 

Gene name
Art2b, ART2.2, ARTC2, Art, Ly92b, Rt-6, Rt6, Rt6-2
Definition
ADP-ribosyltransferase 2b (EC:2.4.2.31)
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     11872 (Art2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 E3; 7 54.61 cM
AA seq 289 aa AA seqDB search
MTSKIFKFFLTWWLTQQVTGLAVPFMLDMAPNAFDDQYESCVEDMEKKAPQLLQEDFNMN
EELKLEWEKAEINWKEIKNSTSYPAGFHDFHGTALVAYTGNLAIDFNRAVRDFKKSPDNF
HYKAFHYYLTRAVQLLNDQGCSLVYRGTKVMFEYTGKGSVRFGQFSSSSLTKRVALSSNF
FSNHGTLFIIRTCLGVNIKEFSSFPREEEVLIPGYEVYHKVTAQNDNGYNEIFLDSPERK
KSNFNCFYNGSAQTVNIDFSISGSRESCVSLFLVVLLGLLVQQLTLAEL
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaaaaattttcaagttcttcctaacttggtggctaacccagcaggtgactggc
cttgcagtgcctttcatgctagacatggctcctaatgcatttgatgatcagtatgagagc
tgtgtcgaagacatggagaaaaaggcaccccagctgttacaagaagacttcaacatgaat
gaggaattaaaacttgagtgggaaaaagcagagataaattggaaagagatcaaaaacagt
acgagttatccggcaggtttccatgatttccatgggacagctttagttgcctacactggg
aacctcgctatagattttaacagagctgttagagacttcaagaaaagtccggataacttc
cactacaaggccttccattactacttaacaagagctgttcagcttttgaatgaccagggt
tgtagtttagtttaccgaggtactaaagtcatgtttgaatacactgggaagggctctgtg
cgatttgggcagttcagttcttcatctttaacaaagagagtagctctttcttcaaatttt
ttcagtaatcatgggacactatttatcatcagaacctgcttgggggttaatatcaaagaa
ttctcctcattccctcgtgaagaggaggtgttaattccaggctatgaagtatatcacaaa
gtcacagcacaaaatgataatgggtataatgaaatatttctggactccccagaaaggaag
aagagcaacttcaattgcttctataatggttctgctcaaacagtcaacattgatttcagt
atatcaggatccagagagagctgtgtatccctgttccttgtggttctcctcggtcttctg
gtccagcagcttactcttgctgagctgtag

DBGET integrated database retrieval system