KEGG   Mus musculus (mouse): 11875Help
Entry
11875             CDS       T01002                                 

Gene name
Art5, ARTC5, Yac-2
Definition
ADP-ribosyltransferase 5 (EC:2.4.2.31)
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     11875 (Art5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 E3; 7 54.71 cM
AA seq 309 aa AA seqDB search
MILEDLLMVLSCLSLHALWKVRAVPILPLSLVPDTFDDAYVGCSEEMEEKAGLLLKEEMA
RHALLRESWEAAQEAWAHRRHKLTLPPGFKAQHGVAIMVYTNSSNTLYWELNQAVRTGGG
SRELYMRHFPFKALHFYLTRALQLLRGSGGCSRGPGEVVFRGVGSLHFEPKRLGDSVRLG
QFTSSSVDERVARRFGNATFFNLRTCFGAPIQALSVFPEEREVLIPPHEVFLVTGFSQDG
AQSIVTLWSYDQTCSHFNCAYLGGEKRRGCVSSRAVGQPEAPSTEALALQSGKTLLLDPR
KLQLSRAGP
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgattctggaggatctgctgatggtcctcagctgcctcagcttgcacgccctctggaag
gttcgagctgttcctatcctgcccctgagcctggttccagatacctttgatgatgcctat
gtgggctgctctgaggagatggaggagaaagcaggcctgctgctaaaggaagagatggca
cgccatgccctgctgcgggaatcctgggaagcagcacaagaggcctgggcacaccggcgt
cacaagctcactctacctcctggcttcaaagcccagcacggagtagcgattatggtgtac
accaactcatccaacaccttgtactgggagctgaaccaggccgtacggacaggaggtggc
tcccgggagctctacatgaggcacttccccttcaaggccctgcatttctacttgacccgg
gctctgcagctgctgcggggctctggagggtgcagtaggggacctggggaggtggtgttc
cgaggtgtgggcagtcttcactttgaacccaagaggctgggggactctgtccgattagga
cagtttacctccagctctgtggatgagagagtggctcgcaggtttgggaatgccaccttc
ttcaatctaaggacttgttttggggctcctatccaggcgttgtctgtcttccctgaggag
cgtgaggtgctgatacccccacacgaagtcttcttggtcactgggttctcccaggatgga
gcccagagcatagtgactctctggagttatgatcagacctgcagccactttaactgcgcc
tatttgggtggggagaagagacgtggctgtgtgtcctcaagagcagtcgggcagccagag
gcaccctccacagaggctctggctctgcaatcaggaaagacactgctcttggacccaagg
aagctgcagctctccagagctggaccctga

DBGET integrated database retrieval system