KEGG   Mus musculus (mouse): 11905Help
Entry
11905             CDS       T01002                                 

Gene name
Serpinc1, AI114908, ATIII, At-3, At3
Definition
(RefSeq) serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1
  KO
K03911  
antithrombin III
Organism
mmu  Mus musculus (mouse)
Pathway
Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    11905 (Serpinc1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   11905 (Serpinc1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Coagulation and fibrinolysis (General comment) Coagulation, inflammation, complement control
   11905 (Serpinc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
1 H2.1; 1 69.75 cM
AA seq 465 aa AA seqDB search
MYSPGAGSGAAGERKLCLLSLLLIGALGCAICHGNPVDDICIAKPRDIPVNPLCIYRSPG
KKATEEDGSEQKVPEATNRRVWELSKANSRFATNFYQHLADSKNDNDNIFLSPLSISTAF
AMTKLGACNDTLKQLMEVFKFDTISEKTSDQIHFFFAKLNCRLYRKANKSSDLVSANRLF
GDKSLTFNESYQDVSEVVYGAKLQPLDFKENPEQSRVTINNWVANKTEGRIKDVIPQGAI
NELTALVLVNTIYFKGLWKSKFSPENTRKEPFYKVDGQSCPVPMMYQEGKFKYRRVAEGT
QVLELPFKGDDITMVLILPKPEKSLAKVEQELTPELLQEWLDELSETMLVVHMPRFRTED
GFSLKEQLQDMGLIDLFSPEKSQLPGIVAGGRDDLYVSDAFHKAFLEVNEEGSEAAASTS
VVITGRSLNPNRVTFKANRPFLVLIREVALNTIIFMGRVANPCVN
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgtattcccctggggcaggaagtggggctgctggtgagaggaagctttgtctcctctct
ctgctcctcatcggtgccttgggctgtgctatctgtcacggaaaccctgtggacgacatc
tgcatagcgaagccccgagacatccccgtgaatcccttgtgcatttaccgctcccctggg
aagaaggccaccgaggaggatggctcagagcagaaggttccagaagccaccaaccggcgg
gtctgggaactgtccaaggccaattcgcgatttgccactaacttctaccagcacctggca
gactccaagaatgacaacgacaacattttcctgtcacccttgagcatctccactgctttt
gctatgaccaagctgggtgcctgtaacgacactctcaagcagctgatggaggtttttaaa
tttgataccatctccgagaagacatccgaccagatccacttcttctttgccaaactgaac
tgccgactctatcgaaaagccaacaagtcctctgacttggtatcagccaaccgccttttt
ggagacaaatccctcaccttcaacgagagctatcaagatgttagtgaggttgtctatgga
gccaagctccagcccctggacttcaaggagaatccggagcaatccagagtgaccatcaac
aactgggtagctaataagactgaaggccgcatcaaagatgtcatcccacagggcgccatt
aacgagctcactgccctggttctggttaacaccatttacttcaagggcctgtggaagtca
aagttcagccctgagaacacaaggaaggaaccgttctataaggtcgatgggcagtcatgc
ccagtgcctatgatgtaccaggaaggcaaattcaaataccggcgcgtggcagagggcacc
caggtgctagagctgcccttcaagggggatgacatcaccatggtgctcatcctgcccaag
cctgagaagagcctggccaaggtggagcaggagctcaccccagagctgctgcaggagtgg
ctggatgagctgtcagagactatgcttgtggtccacatgccccgcttccgcaccgaggat
ggcttcagtctgaaggagcagctgcaagacatgggcctcattgatctcttcagccctgaa
aagtcccaactcccagggatcgttgctggaggcagggacgacctctatgtctccgacgca
ttccacaaagcatttcttgaggtaaatgaggaaggcagtgaagcagcagcgagtacttct
gtcgtgattactggccggtcactgaaccccaatagggtgaccttcaaggccaacaggccc
ttcctggttcttataagggaagttgcactgaacactattatattcatggggagagtggct
aatccttgtgtgaactaa

DBGET integrated database retrieval system