KEGG   Mus musculus (mouse): 11909Help
Entry
11909             CDS       T01002                                 

Gene name
Atf2, Atf-2, CRE-BP, Creb2, D130078H02Rik, D18875, Tg(Gzma-Klra1)7Wum, mXBP
Definition
(RefSeq) activating transcription factor 2
  KO
K04450  
cyclic AMP-dependent transcription factor ATF-2
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
cGMP-PKG signaling pathway
PI3K-Akt signaling pathway
Longevity regulating pathway
Adrenergic signaling in cardiomyocytes
TNF signaling pathway
Dopaminergic synapse
Insulin secretion
Estrogen signaling pathway
Thyroid hormone synthesis
Glucagon signaling pathway
Aldosterone synthesis and secretion
Cocaine addiction
Amphetamine addiction
Alcoholism
Hepatitis B
Influenza A
HTLV-I infection
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    11909 (Atf2)
   04668 TNF signaling pathway
    11909 (Atf2)
   04022 cGMP - PKG signaling pathway
    11909 (Atf2)
   04151 PI3K-Akt signaling pathway
    11909 (Atf2)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    11909 (Atf2)
   04922 Glucagon signaling pathway
    11909 (Atf2)
   04915 Estrogen signaling pathway
    11909 (Atf2)
   04918 Thyroid hormone synthesis
    11909 (Atf2)
   04925 Aldosterone synthesis and secretion
    11909 (Atf2)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    11909 (Atf2)
  Nervous system
   04728 Dopaminergic synapse
    11909 (Atf2)
  Aging
   04211 Longevity regulating pathway - mammal
    11909 (Atf2)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    11909 (Atf2)
  Substance dependence
   05030 Cocaine addiction
    11909 (Atf2)
   05031 Amphetamine addiction
    11909 (Atf2)
   05034 Alcoholism
    11909 (Atf2)
  Infectious diseases
   05166 HTLV-I infection
    11909 (Atf2)
   05164 Influenza A
    11909 (Atf2)
   05161 Hepatitis B
    11909 (Atf2)
   05169 Epstein-Barr virus infection
    11909 (Atf2)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    11909 (Atf2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2; 2 C3
AA seq 487 aa AA seqDB search
MSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARNDSVIVADQTPTPTRFLKN
CEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIRSKIEEPSVVETTHQDSPL
PHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSDSSVIIQQAVPSPTSSTVI
TQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNVHVPAAVPLVRPVTMVPSV
PGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGSGLVRTQSEESRPQSLQQP
ATSTTETPASPAHTTPQTQNTSGRRRRAANEDPDEKRRKFLERNRAAASRCRQKRKVWVQ
SLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPVTAMQKKSGYHTADKDDSS
EDLSVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQMADQSTEPALSQIVMAPPS
QAQPSGS
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatgacaaaccctttctatgcactgcccctgggtgtggccagcgttttaccaac
gaggatcatttggctgtccataaacataaacatgagatgacactgaaatttggtccagca
cgtaatgacagtgtcattgtggctgatcagactccaacgccaacaagattcctaaaaaac
tgtgaagaagtgggtttgttcaatgagttggcaagtccatttgaaaatgaattcaagaag
gcttccgaagatgacattaaaaaaatgcctctagatttgtcccctcttgcaacacccatc
ataagaagcaaaattgaggagccttctgttgtagaaacaactcaccaggacagcccttta
cctcaccccgagtcgactaccagtgatgaaaaggaagtaccattggcacaaactgcacag
cccacatcagctatcgttcgtccagcatcattacaggttcccaatgtgctgctcacaagt
tctgactcaagtgtaattattcaacaagcagtaccttcaccaacctcaagtactgtaatc
acccaggcaccatcctctaacaggccaattgttcctgtaccaggcccatttcctcttctc
ttacatcttcctaatggacaaaccatgcccgttgctattcctgcatcaattacaagttct
aatgtgcatgttccagctgcagtcccacttgttcggccagtcaccatggtgcctagtgtt
ccaggaatcccaggcccttcctctcctcaaccagtccagtcagaagcaaaaatgagatta
aaagctgctttgacccagcaacaccctccagttaccaatggtgatactgtaaaaggccat
ggcagtggattggttaggactcagtcagaagagtctcgcccacagtccttgcagcagcca
gccacctccactacagaaactccggcttctccagctcacacaactcctcagacccaaaat
acaagtggccgtcgaagaagagcagctaatgaagatcctgatgagaaaaggaggaagttt
ctagaacgaaatagagcagcagcttcaagatgccgacaaaaaaggaaagtgtgggttcag
tccttagagaagaaagcagaagacttgagttcactaaatggccagctgcagagcgaagtc
accctgctgagaaatgaagtggcccagctgaaacagcttcttctggctcataaagattgc
cctgtaactgccatgcagaagaagtctggctatcatactgctgataaagatgacagttca
gaagacctttctgtgccaagcagtccacatacagaagcgatccagcacagctctgtcagc
acatccaatggagtcagttcaacatcaaaagcagaagctgtagccacttcagtcctcacc
cagatggcggaccagagcacggagcctgcactttcacagattgtcatggctcctccctcc
caggcacagccctcaggaagttga

DBGET integrated database retrieval system