KEGG   Mus musculus (mouse): 11941Help
Entry
11941             CDS       T01002                                 

Gene name
Atp2b2, D6Abb2e, Gena300, PMCA2, Tmy, dfw, jog, wms, wri
Definition
(RefSeq) ATPase, Ca++ transporting, plasma membrane 2
  KO
K05850  
Ca2+ transporting ATPase, plasma membrane [EC:3.6.3.8]
Organism
mmu  Mus musculus (mouse)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Adrenergic signaling in cardiomyocytes
Aldosterone synthesis and secretion
Salivary secretion
Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    11941 (Atp2b2)
   04024 cAMP signaling pathway
    11941 (Atp2b2)
   04022 cGMP - PKG signaling pathway
    11941 (Atp2b2)
 Organismal Systems
  Endocrine system
   04925 Aldosterone synthesis and secretion
    11941 (Atp2b2)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    11941 (Atp2b2)
  Digestive system
   04970 Salivary secretion
    11941 (Atp2b2)
   04972 Pancreatic secretion
    11941 (Atp2b2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.8  Ca2+-transporting ATPase
     11941 (Atp2b2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6 E3; 6 52.85 cM
AA seq 1198 aa AA seqDB search
MGDMTNSDFYSKNQRNESSHGGEFGCTMEELRSLMELRGTEAVVKIKETYGDTEAICRRL
KTSPVEGLPGTAPDLEKRKQIFGQNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIISLG
LSFYHPPGESNEGCATAQGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFR
GLQSRIEQEQKFTVVRAGQVVQIPVAEIVVGDIAQIKYGDLLPADGLFIQGNDLKIDESS
LTGESDQVRKSVDKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKD
KKAKQQDGAAAMEMQPLKSAEGGDADDKKKANMHKKEKSVLQGKLTKLAVQIGKAGLVMS
AITVIILVLYFTVDTFVVNKKPWLTECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTI
SLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAYVGDVHYKEIP
DPSSINAKTLELLVNAIAINSAYTTKILPPEKEGALPRQVGNKTECGLLGFVLDLRQDYE
PVRSQMPEEKLYKVYTFNSVRKSMSTVIKMPDESFRMYSKGASEIVLKKCCKILSGAGEA
RVFRPRDRDEMVKKVIEPMACDGLRTICVAYRDFPSSPEPDWDNENDILNELTCICVVGI
EDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAIKCGIIHPGEDFLCLEGKEFNRR
IRNEKGEIEQERIDKIWPKLRVLARSSPTDKHTLVKGIIDSTHTEQRQVVAVTGDGTNDG
PALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTV
NVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTETLLLRKPYGRNKP
LISRTMMKNILGHAVYQLTLIFTLLFVGEKMFQIDSGRNAPLHSPPSEHYTIIFNTFVMM
QLFNEINARKIHGERNVFDGIFRNPIFCTIVLGTFAIQIVIVQFGGKPFSCSPLQLDQWM
WCIFIGLGELVWGQVIATIPTSRLKFLKEAGRLTQKEEIPEEELNEDVEEIDHAERELRR
GQILWFRGLNRIQTQIRVVKAFRSSLYEGLEKPESRTSIHNFMAHPEFRIEDSQPHIPLI
DDTDLEEDAALKQNSSPPSSLNKNNSAIDSGINLTTDTSKSATSSSPGSPIHSLETSL
NT seq 3597 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacatgaccaacagcgacttttactccaaaaaccaaagaaatgagtcgagccat
gggggcgagttcgggtgcaccatggaggagctgcgctccctcatggagctgcggggcacc
gaggctgtggtcaagatcaaggagacgtatggggacactgaagccatctgccggcgcctc
aaaacctcgcctgttgaaggtttaccaggcactgctccagacttggaaaagaggaaacag
atttttgggcaaaacttcatacctccaaagaaaccaaaaaccttcctgcagctggtgtgg
gaagcgctacaggacgtgacacttatcatcctggagatcgcggccatcatctccctggga
ctgtccttctaccacccaccgggagagagcaatgaaggatgtgccacggcccagggtggg
gcagaggatgaaggtgaagcagaagcaggctggattgagggggctgccatcctgctgtca
gtcatctgtgtggtcctggtcacagccttcaatgactggagtaaggagaaacagttccgg
ggcctgcagagccgaattgagcaggagcagaagttcactgtggtccgggccggccaggtg
gttcagatccctgtggccgagatcgtggtcggggacattgcccagatcaaatatggtgac
cttcttcccgctgatggcctcttcatccagggaaatgacctcaaaattgatgaaagctca
ctcacaggggaatctgaccaggtgcgcaagtctgtggataaggaccccatgttgctgtca
ggaacccatgtgatggagggctcaggacggatggtggttactgctgtgggtgtgaactct
cagactggcatcatatttaccctgcttggggctggtggtgaagaggaagagaagaaagac
aaaaaagccaagcagcaggatggggcagctgccatggagatgcagcctctgaagagtgca
gagggcggcgatgcagatgacaagaagaaagccaacatgcacaagaaagagaagtcggtg
cttcagggcaagctcaccaaactggctgtgcagataggcaaggcgggcctggtgatgtcg
gccatcacagtgatcatcctggtactctacttcaccgtggacaccttcgtggtcaacaag
aagccatggctgacggaatgcacacccgtctacgtacagtactttgtcaagttcttcatc
attggtgtgacggtgctggtggtcgctgtgcccgagggcctccctctggctgtcaccatc
tcactggcctattctgtgaagaaaatgatgaaggacaacaacctggtacgccacctggat
gcctgtgagaccatgggcaatgccacagccatctgctcagacaagacaggaacgctgacc
accaaccgcatgaccgtggtccaggcctatgtcggtgacgtccactacaaggagatcccc
gatcccagctccatcaatgccaagacgctggagctgctggtcaacgccattgccatcaac
agcgcctacaccaccaagatccttcccccagaaaaagagggagccctgccccggcaggtg
ggcaacaagacagagtgcggcctgctgggctttgtgctggacttgaggcaggactacgag
ccggtgcgcagccagatgccagaggagaagctgtataaggtgtacaccttcaactccgtg
cgcaagtccatgagcaccgtcatcaagatgcccgacgagagcttccgcatgtacagcaag
ggcgcctcggagattgtgctcaaaaagtgctgcaagatcctcagtggggcaggggaagcc
cgtgtcttccggccccgagacagggatgagatggttaagaaggtgattgagcccatggcc
tgtgacgggctccgtaccatctgcgtggcctatcgtgacttccccagcagccctgagcct
gactgggacaatgagaatgacattctcaatgaactcacgtgcatctgcgtggtgggcatc
gaagacccagtacgacctgaggtcccagaagccatccgcaagtgccagcgggcaggtatc
acagtccgcatggtcaccggtgacaatatcaacacagcccgggccatcgccatcaagtgt
ggcattatccaccctggagaggacttcctgtgcctggaaggcaaagaattcaatcggagg
attcgcaacgagaagggggagattgagcaggagcggattgacaagatctggccaaagctg
agggtgctggctcgctcctcgcccacggataagcacacgctggtcaaaggcatcatcgac
agtacacacactgagcagcggcaggtggtggctgtgacaggggatgggaccaacgacggg
cctgctctcaagaaggcagatgtgggcttcgcaatgggcatcgcaggcacagatgtggcc
aaggaggcctcagacatcatcctgacagatgacaacttcagcagcatcgtcaaggcagtg
atgtggggccgtaacgtctatgacagcatatccaaattcctgcagttccagctgactgtc
aacgtggtggcggtgatcgtggccttcacgggcgcctgcattacacaggactcccctctc
aaggctgtgcagatgctctgggtgaacctcatcatggacacgtttgcctccctggccctg
gccacagagccacctacggagactctgcttctgaggaaaccgtacggtcgcaacaagccg
ctcatctcgaggaccatgatgaagaacatcctgggccacgccgtctaccagctcaccctc
atcttcaccctgctcttcgtgggtgagaagatgttccagatcgacagcggaaggaacgcc
ccgctgcactcaccaccctcagagcactacaccatcatcttcaacaccttcgtcatgatg
cagcttttcaacgagatcaacgcccgcaagatccacggcgagcgcaacgtctttgacggg
atcttccggaaccccatcttctgcaccatcgttcttggcactttcgccatccagatagtg
atcgtgcagtttggcgggaagcccttcagctgctccccactccagctggaccagtggatg
tggtgcatcttcataggcctgggagagctcgtctggggccaggtcatcgccaccatccct
accagcaggctcaagttcctgaaagaggcagggcgtctaacacagaaggaggagatcccc
gaggaggagttaaatgaggatgtggaagagatagaccacgcagagcgggagcttcgccgt
ggccagatcctgtggttccggggcctgaatcggatccagacacagatccgcgtcgtgaag
gcgttccgtagctctctctatgaagggttagaaaaacccgagtctcgaacctccatccat
aacttcatggctcatcctgaattccggatcgaagattcccagccccacatccccctcatc
gatgacaccgacctggaagaagatgccgcgctcaagcagaactcgagcccgccgtcctcg
ctcaacaagaacaatagcgccatcgacagcgggatcaacctgacgaccgacacgagcaaa
tcagctacctcttcaagtccagggagccccatccacagcctggagacgtcgctttag

DBGET integrated database retrieval system