KEGG   Mus musculus (mouse): 11941Help
Entry
11941             CDS       T01002                                 

Gene name
Atp2b2, D6Abb2e, Gena300, PMCA2, Tmy, dfw, jog, wms, wri
Definition
(RefSeq) ATPase, Ca++ transporting, plasma membrane 2 (EC:3.6.3.8)
  KO
K05850  
Ca2+ transporting ATPase, plasma membrane [EC:3.6.3.8]
Organism
mmu  Mus musculus (mouse)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Adrenergic signaling in cardiomyocytes
Salivary secretion
Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    11941 (Atp2b2)
   04024 cAMP signaling pathway
    11941 (Atp2b2)
   04022 cGMP - PKG signaling pathway
    11941 (Atp2b2)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    11941 (Atp2b2)
  Digestive system
   04970 Salivary secretion
    11941 (Atp2b2)
   04972 Pancreatic secretion
    11941 (Atp2b2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.8  Ca2+-transporting ATPase
     11941 (Atp2b2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6 E3; 6 52.85 cM
AA seq 1198 aa AA seqDB search
MGDMTNSDFYSKNQRNESSHGGEFGCTMEELRSLMELRGTEAVVKIKETYGDTEAICRRL
KTSPVEGLPGTAPDLEKRKQIFGQNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIISLG
LSFYHPPGESNEGCATAQGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFR
GLQSRIEQEQKFTVVRAGQVVQIPVAEIVVGDIAQIKYGDLLPADGLFIQGNDLKIDESS
LTGESDQVRKSVDKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKD
KKAKQQDGAAAMEMQPLKSAEGGDADDKKKANMHKKEKSVLQGKLTKLAVQIGKAGLVMS
AITVIILVLYFTVDTFVVNKKPWLTECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTI
SLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAYVGDVHYKEIP
DPSSINAKTLELLVNAIAINSAYTTKILPPEKEGALPRQVGNKTECGLLGFVLDLRQDYE
PVRSQMPEEKLYKVYTFNSVRKSMSTVIKMPDESFRMYSKGASEIVLKKCCKILSGAGEA
RVFRPRDRDEMVKKVIEPMACDGLRTICVAYRDFPSSPEPDWDNENDILNELTCICVVGI
EDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAIKCGIIHPGEDFLCLEGKEFNRR
IRNEKGEIEQERIDKIWPKLRVLARSSPTDKHTLVKGIIDSTHTEQRQVVAVTGDGTNDG
PALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTV
NVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTETLLLRKPYGRNKP
LISRTMMKNILGHAVYQLTLIFTLLFVGEKMFQIDSGRNAPLHSPPSEHYTIIFNTFVMM
QLFNEINARKIHGERNVFDGIFRNPIFCTIVLGTFAIQIVIVQFGGKPFSCSPLQLDQWM
WCIFIGLGELVWGQVIATIPTSRLKFLKEAGRLTQKEEIPEEELNEDVEEIDHAERELRR
GQILWFRGLNRIQTQIRVVKAFRSSLYEGLEKPESRTSIHNFMAHPEFRIEDSQPHIPLI
DDTDLEEDAALKQNSSPPSSLNKNNSAIDSGINLTTDTSKSATSSSPGSPIHSLETSL
NT seq 3597 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacatgaccaacagcgacttttactccaaaaaccaaagaaatgagtcgagccat
gggggcgagttcgggtgcaccatggaggagctgcgctccctcatggagctgcggggcacc
gaggctgtggtcaagatcaaggagacgtatggggacactgaagccatctgccggcgcctc
aaaacctcgcctgttgaaggtttaccaggcactgctccagacttggaaaagaggaaacag
atttttgggcaaaacttcatacctccaaagaaaccaaaaaccttcctgcagctggtgtgg
gaagcgctacaggacgtgacacttatcatcctggagatcgcggccatcatctccctggga
ctgtccttctaccacccaccgggagagagcaatgaaggatgtgccacggcccagggtggg
gcagaggatgaaggtgaagcagaagcaggctggattgagggggctgccatcctgctgtca
gtcatctgtgtggtcctggtcacagccttcaatgactggagtaaggagaaacagttccgg
ggcctgcagagccgaattgagcaggagcagaagttcactgtggtccgggccggccaggtg
gttcagatccctgtggccgagatcgtggtcggggacattgcccagatcaaatatggtgac
cttcttcccgctgatggcctcttcatccagggaaatgacctcaaaattgatgaaagctca
ctcacaggggaatctgaccaggtgcgcaagtctgtggataaggaccccatgttgctgtca
ggaacccatgtgatggagggctcaggacggatggtggttactgctgtgggtgtgaactct
cagactggcatcatatttaccctgcttggggctggtggtgaagaggaagagaagaaagac
aaaaaagccaagcagcaggatggggcagctgccatggagatgcagcctctgaagagtgca
gagggcggcgatgcagatgacaagaagaaagccaacatgcacaagaaagagaagtcggtg
cttcagggcaagctcaccaaactggctgtgcagataggcaaggcgggcctggtgatgtcg
gccatcacagtgatcatcctggtactctacttcaccgtggacaccttcgtggtcaacaag
aagccatggctgacggaatgcacacccgtctacgtacagtactttgtcaagttcttcatc
attggtgtgacggtgctggtggtcgctgtgcccgagggcctccctctggctgtcaccatc
tcactggcctattctgtgaagaaaatgatgaaggacaacaacctggtacgccacctggat
gcctgtgagaccatgggcaatgccacagccatctgctcagacaagacaggaacgctgacc
accaaccgcatgaccgtggtccaggcctatgtcggtgacgtccactacaaggagatcccc
gatcccagctccatcaatgccaagacgctggagctgctggtcaacgccattgccatcaac
agcgcctacaccaccaagatccttcccccagaaaaagagggagccctgccccggcaggtg
ggcaacaagacagagtgcggcctgctgggctttgtgctggacttgaggcaggactacgag
ccggtgcgcagccagatgccagaggagaagctgtataaggtgtacaccttcaactccgtg
cgcaagtccatgagcaccgtcatcaagatgcccgacgagagcttccgcatgtacagcaag
ggcgcctcggagattgtgctcaaaaagtgctgcaagatcctcagtggggcaggggaagcc
cgtgtcttccggccccgagacagggatgagatggttaagaaggtgattgagcccatggcc
tgtgacgggctccgtaccatctgcgtggcctatcgtgacttccccagcagccctgagcct
gactgggacaatgagaatgacattctcaatgaactcacgtgcatctgcgtggtgggcatc
gaagacccagtacgacctgaggtcccagaagccatccgcaagtgccagcgggcaggtatc
acagtccgcatggtcaccggtgacaatatcaacacagcccgggccatcgccatcaagtgt
ggcattatccaccctggagaggacttcctgtgcctggaaggcaaagaattcaatcggagg
attcgcaacgagaagggggagattgagcaggagcggattgacaagatctggccaaagctg
agggtgctggctcgctcctcgcccacggataagcacacgctggtcaaaggcatcatcgac
agtacacacactgagcagcggcaggtggtggctgtgacaggggatgggaccaacgacggg
cctgctctcaagaaggcagatgtgggcttcgcaatgggcatcgcaggcacagatgtggcc
aaggaggcctcagacatcatcctgacagatgacaacttcagcagcatcgtcaaggcagtg
atgtggggccgtaacgtctatgacagcatatccaaattcctgcagttccagctgactgtc
aacgtggtggcggtgatcgtggccttcacgggcgcctgcattacacaggactcccctctc
aaggctgtgcagatgctctgggtgaacctcatcatggacacgtttgcctccctggccctg
gccacagagccacctacggagactctgcttctgaggaaaccgtacggtcgcaacaagccg
ctcatctcgaggaccatgatgaagaacatcctgggccacgccgtctaccagctcaccctc
atcttcaccctgctcttcgtgggtgagaagatgttccagatcgacagcggaaggaacgcc
ccgctgcactcaccaccctcagagcactacaccatcatcttcaacaccttcgtcatgatg
cagcttttcaacgagatcaacgcccgcaagatccacggcgagcgcaacgtctttgacggg
atcttccggaaccccatcttctgcaccatcgttcttggcactttcgccatccagatagtg
atcgtgcagtttggcgggaagcccttcagctgctccccactccagctggaccagtggatg
tggtgcatcttcataggcctgggagagctcgtctggggccaggtcatcgccaccatccct
accagcaggctcaagttcctgaaagaggcagggcgtctaacacagaaggaggagatcccc
gaggaggagttaaatgaggatgtggaagagatagaccacgcagagcgggagcttcgccgt
ggccagatcctgtggttccggggcctgaatcggatccagacacagatccgcgtcgtgaag
gcgttccgtagctctctctatgaagggttagaaaaacccgagtctcgaacctccatccat
aacttcatggctcatcctgaattccggatcgaagattcccagccccacatccccctcatc
gatgacaccgacctggaagaagatgccgcgctcaagcagaactcgagcccgccgtcctcg
ctcaacaagaacaatagcgccatcgacagcgggatcaacctgacgaccgacacgagcaaa
tcagctacctcttcaagtccagggagccccatccacagcctggagacgtcgctttag

DBGET integrated database retrieval system