KEGG   Mus musculus (mouse): 11946Help
Entry
11946             CDS       T01002                                 

Gene name
Atp5a1, AI035633, AL022851, AL023067, Atpm, D18Ertd206e, Mom2
Definition
(RefSeq) ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit 1
  KO
K02132  
F-type H+-transporting ATPase subunit alpha
Organism
mmu  Mus musculus (mouse)
Pathway
Oxidative phosphorylation
Metabolic pathways
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    11946 (Atp5a1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    11946 (Atp5a1)
   05012 Parkinson's disease
    11946 (Atp5a1)
   05016 Huntington's disease
    11946 (Atp5a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
18 E3; 18 52.38 cM
AA seq 553 aa AA seqDB search
MLSVRVAAAVARALPRRAGLVSKNALGSSFVGARNLHASNTRLQKTGTAEMSSILEERIL
GADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFG
NDKLIKEGDVVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKTRRRVGLKAPGII
PRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKK
KLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYF
RDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDSFG
GGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSA
AQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMA
IEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVISQHQSLLGNIRSDGKISEQSDAKL
KEIVTNFLAGFEP
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgctgtctgtgcgcgtcgccgcggccgtggcccgtgccctccctcgacgggcgggactg
gtctccaaaaatgctttggggtcatcctttgttggtgcaagaaatctccatgcctctaac
actcgacttcagaagactggcacagctgagatgtcctccattctcgaggagaggattctg
ggagctgacacgtctgttgacctggaggagactgggcgtgtgttaagcattggtgatggt
attgcgcgagtgcacgggctgaggaatgttcaagcagaggagatggtggaattctcttca
ggcttaaagggtatgtccctgaacttggaacccgacaatgttggagttgtcgtgtttggg
aatgacaagctaattaaagaaggagacgttgtgaagaggacaggcgccatcgtggatgtc
cccgttggcgaggagctgttgggccgtgtggttgacgccctcggtaatgctattgatgga
aagggtccaattggttccaagacccgcagacgagtgggcctgaaagcccctggaattatc
ccccgaatctctgtgcgggagccgatgcagaccggcatcaaggctgtggatagcctggtg
cccattggccggggtcagcgtgagctgattattggtgacagacagactgggaaaacatcg
attgccattgacacaatcatcaaccagaaacgtttcaacgatgggaccgacgagaagaag
aagctgtactgcatctacgtcgcgattggtcagaagcggtccactgtggctcagctggtg
aagagactgacggatgcggatgccatgaagtacaccatcgtggtgtcagccactgcctct
gacgctgccccgcttcagtacttggctccctactccggctgctccatgggagagtacttt
agagacaacggcaagcacgctttgatcatctatgacgatctatccaagcaggctgtcgct
taccgccagatgtctctgttgctccgccgaccccctggtcgtgaggcctatcctggtgat
gtgttctacctacactcccgcctgctggagagagcagccaagatgaacgattcctttggt
ggtggctctttgactgccttaccagtcattgaaacacaggctggtgatgtgtccgcttac
attccaacaaatgttatttccatcactgacggacagatcttcttggaaacagaattgttc
tataaaggcatccgccctgccattaatgtgggtttgtctgtgtcccgtgtcggatctgct
gcccaaaccagagccatgaagcaggtggcaggtaccatgaagctggagttggctcagtac
cgggaggtggctgcgtttgcccagtttggttctgatttggacgctgccactcaacagctc
ttgagtcgtggtgtgcgtctgaccgagttgctaaagcaaggacagtactctcccatggct
attgaagaacaggtggctgttatctatgcgggtgtacggggttatcttgacaaactggag
cccagcaagatcacaaagtttgagaatgctttcttgtctcacgttatcagccagcaccag
tccctcttgggcaatatcaggtctgatgggaaaatctcagaacagtcagacgcaaagctc
aaagagattgtaacaaacttcttggctgggtttgaaccataa

DBGET integrated database retrieval system