KEGG   Mus musculus (mouse): 11994Help
Entry
11994             CDS       T01002                                 

Gene name
Pcdh15, BB078305, Gm9815, Ush1f, av, nmf19, roda
Definition
(RefSeq) protocadherin 15
  KO
K16500  
protocadherin-15
Organism
mmu  Mus musculus (mouse)
Brite
Cell adhesion molecules and their ligands [BR:mmu04516]
 5. Cadherin Family
  Classic Cadherins
   Other classic cadherins
    CDH23; cadherin 23 [KO:K06813]
     11994 (Pcdh15)
  Non-clustered protocadherin
   PCDH15; protocadherin-15 [KO:K16500]
    11994 (Pcdh15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10 B5.3; 10 37.43 cM
AA seq 1943 aa AA seqDB search
MFLQFAVWKCLPHGILIASLLVVSWGQYDDDWQYEDCKLARGGPPATIVAIDEESRNGTI
LVDNMLIKGTAGGPDPTIELSLKDNVDYWVLLDPVKQMLFLNSTGRVLDRDPPMNIHSIV
VQVQCVNKKVGTVIYHEVRIVVRDRNDNSPTFKHESYYATVNELTPVGTTIFTGFSGDNG
ATDIDDGPNGQIEYVIQYNPEDPTSNDTFEIPLMLTGNVVLRKRLNYEDKTRYYVIIQAN
DRAQNLNERRTTTTTLTVDVLDGDDLGPMFLPCVLVPNTRDCRPLTYQAAIPELRTPEEL
NPILVTPPIQAIDQDRNIQPPSDRPGILYSILVGTPEDYPRFFHMHPRTAELTLLEPVNR
DFHQKFDLVIKAEQDNGHPLPAFASLHIEILDENNQSPYFTMPSYQGYILESAPVGATIS
ESLNLTTPLRIVALDKDIEDTKDPELHLFLNDYTSVFTVTPTGITRYLTLLQPVDREEQQ
TYTFLITAFDGVQESEPVVVNIRVMDANDNTPTFPEISYDVYVYTDMSPGDSVIQLTAVD
ADEGSNGEISYEILVGGKGDFVINKTTGLVSIAPGVELIVGQTYALTVQASDNAPPAERR
HSICTVYIEVLPPNNQSPPRFPQLMYSLEVSEAMRIGAILLNLQATDREGDPITYAIENG
DPQRVFNLSETTGILSLGKALDRESTDRYILIVTASDGRPDGTSTATVNIVVTDVNDNAP
VFDPYLPRNLSVVEEEANAFVGQVRATDPDAGINGQVHYSLGNFNNLFRITSNGSIYTAV
KLNREARDHYELVVVATDGAVHPRHSTLTLYIKVLDIDDNSPVFTNSTYTVVVEENLPAG
TSFLQIEAKDVDLGANVSYRIRSPEVKHLFALHPFTGELSLLRSLDYEAFPDQEASITFL
VEAFDIYGTMPPGIATVTVIVKDMNDYPPVFSKRIYKGMVAPDAVKGTPITTVYAEDADP
PGMPASRVRYRVDDVQFPYPASIFDVEEDSGRVVTRVNLNEEPTTIFKLVVVAFDDGEPV
MSSSATVRILVLHPGEIPRFTQEEYRPPPVSELAARGTVVGVISAAAINQSIVYSIVAGN
EEDKFGINNVTGVIYVNSPLDYETRTSYVLRVQADSLEVVLANLRVPSKSNTAKVYIEIQ
DENDHPPVFQKKFYIGGVSEDARMFASVLRVKATDRDTGNYSAMAYRLIIPPIKEGKEGF
VVETYTGLIKTAMLFHNMRRSYFKFQVIATDDYGKGLSGKADVLVSVVNQLDMQVIVSNV
PPTLVEKKIEDLTEILDRYVQEQIPGAKVVVESIGARRHGDAYSLEDYSKCDLTVYAIDP
QTNRAIDRNELFKFLDGKLLDINKDFQPYYGEGGRILEIRTPEAVTSIKKRGESLGYTEG
ALLALAFIIILCCIPAILVVLVSYRQFKVRQAECTKTARIQSAMPAAKPAAPVPAAPAPP
PPPPPPPPGAHLYEELGESAMHNLFLLYHFEQSRGNNSVPEDRSSHRDGMAFSSSTTESH
EPAHVEGPLKESQPNPARTFSFVPDEDNLSTHNPLYMESIGQRSTNSDLQPRTDFEELLA
PRTQVKSQSLRGPREKIQRVWNQSVSFPRRLMWKAPNRPETIDLVEWQITNQRAECESAR
CHPSQRGSSNVLLATEDAHESEKEGGHRDTLIVQQTEQLKSLSSGSSFSSSWSHFSFSTL
PTISRAVELGSEPNVVTSPADCTLELSPPLRPRILNSLSSKRETPTCASDTEPKRNSFEI
APHPPSISAPLPHPPLPRPPIAFTTFPLPLSPPNPPPPQLVTFSLPISTPPTSSLPLPPP
LSLPPPPRPPAPRLFPQPPSTSIPSTDSISAPAAKCTASATHARETTSTTQPPASNPQWG
AEPHRHPKGILRHVKNLAELEKSVSNMYSHIEKNCPPADPSKLHTFCPAEKTGMKITHDQ
SQETLVRVVEGIDVQPHSQSTSL
NT seq 5832 nt NT seq  +upstreamnt  +downstreamnt
atgttcctacagtttgctgtctggaagtgtttaccccatgggatcctcattgcctctctc
ttggtagtcagctggggccagtatgacgatgactggcaatacgaggattgcaaactagct
aggggaggaccaccagctactatcgtggccattgatgaagagagtcgaaacggtacaatt
ctggtggataacatgttgattaaggggactgccggaggaccagaccccaccatagagctc
tctttaaaggacaacgtggactactgggtgttgctggaccccgttaaacagatgcttttc
ctgaacagtaccggaagagttctggatagagacccaccaatgaacatacactccattgtg
gtgcaagtccagtgtgtcaacaagaaggttggcacagttatctatcatgaagtacgcatc
gtggtgcgagatcggaatgacaactcccccacattcaagcatgaaagctactatgccacc
gtgaatgagctcactccagttggcaccacgatattcacggggttctcgggagacaatgga
gctacagacatagacgatggccctaatggacagatagaatacgtgattcagtacaaccca
gaagatccgacatccaacgacacctttgaaattccactcatgctgactggcaacgtggta
ctgaggaaaagactcaactatgaggataagactcgctactatgtcatcatccaagcaaat
gaccgtgcacaaaatctgaatgagaggcgaacaaccaccaccaccctcacagtagatgtt
ctagatggagatgacctgggacctatgtttctgccttgtgttcttgtgccaaacacacgt
gactgtcgtccactcacctaccaagctgccattcctgaactgaggactccggaagaactg
aaccctattttggtgacaccacctatccaagccattgatcaggaccgaaacatccaacca
ccatctgatcgacctggcatcctctactccatccttgtcggcacccctgaggattacccc
cgcttcttccatatgcatcccaggactgcagaactcactctcctggagccagtaaacaga
gacttccatcaaaaatttgatttggttattaaggctgagcaggacaatggccacccactt
cctgcctttgctagtctgcacatcgaaatactagacgaaaacaatcagagtccatacttc
acaatgcccagctatcaaggatacatcctggaatccgccccagtgggagccaccatttct
gagagcctaaacttaaccactcctctgagaattgtagctctggacaaagacatagaagac
acaaaagatccagagctccacctcttcctgaatgactacacctcggtcttcactgtgaca
cccactggtatcacccgctacctcaccctgcttcaacctgtggacagggaggaacagcaa
acctacacctttctgataacagcgtttgatggcgtgcaagaaagtgagccagtcgtggtc
aatatccgagtgatggatgcaaatgataacacgcccaccttccctgaaatctcctatgat
gtctatgtttacacagacatgagtcctggggacagcgtcattcagctgacagcggtagat
gctgatgaaggctctaatggggagatctcctatgaaatactggtggggggcaagggagac
ttcgtgatcaacaagaccacagggctggtgagcattgcaccaggcgtggagctgatcgtg
ggacagacgtatgcgctcacagtgcaggcttcggacaacgccccgcctgcagaaagaagg
cactccatctgcacagtgtacatcgaggtgcttcctcctaacaaccagagccctccccgc
ttcccgcagctgatgtacagtctggaagtcagcgaggccatgaggatcggtgctatttta
ttaaatctacaggcaactgatcgagagggagatccaatcacatatgccatcgagaatgga
gaccctcagagagtttttaatctttcagaaaccacagggattctcagcctagggaaggct
ctagaccgcgagagcacagaccgctacatcctcatcgtcacagcctcagatggcagaccg
gatggaacctcaactgccactgtgaacatagtggtgacggacgtcaatgacaacgctccc
gtgttcgatccctatctgcccaggaacctctctgtggtggaggaagaagccaatgccttt
gtgggtcaagtccgggcaacagacccagatgctgggataaacggccaagttcactacagc
ctggggaacttcaacaacctcttccgcatcacatccaacgggagcatttacacagccgtg
aagctgaacagggaagccagggaccactatgaactggttgtcgtggcaacagatggagca
gtccaccctcgacattcaactctgacactgtacatcaaggtgttggacattgatgataac
agtcctgtttttaccaattcaacgtacacagttgtcgttgaagagaatctgccagccggg
acctcctttcttcaaatagaggccaaggatgttgaccttggagccaatgtgtcatatcgg
atcagaagcccagaagtgaaacacctttttgcactgcatccattcactggagaattgtct
cttctgaggagtttggattatgaggcctttccggaccaggaggcaagcatcacattcttg
gtggaggcctttgacatttatgggactatgccacctggtatagcaacagtcacggtaatt
gtgaaggacatgaatgactaccctccagtgtttagcaaacgcatctacaaggggatggtg
gctccagatgcagtcaaggggacaccaatcaccaccgtttatgctgaagatgcggaccca
cctgggatgcctgcaagtagggtgaggtatcgagtggacgacgtgcagtttccataccca
gccagtatttttgatgtagaggaagattctggaagagtagtaacccgcgtcaatcttaat
gaagagcctactacgattttcaagctggtggttgtggcttttgatgacggcgaacctgtg
atgtccagcagtgccacggtgagaattcttgtcttacatcctggagagatcccacgcttc
acccaagaggaatacagacctcctcctgtaagtgagcttgcggccagagggactgtagtt
ggtgtcatttctgctgctgccattaatcagagcatcgtgtactccattgtggcaggaaat
gaggaagacaagtttggaatcaacaatgtcactggggtcatctatgtgaattcaccattg
gattacgagacaaggaccagctatgtgctccgggtacaagcagattctctggaagtggtc
cttgccaatctccgagtcccttcaaaaagcaatacagctaaggtgtacattgagattcag
gatgaaaacgatcaccccccagtgttccagaagaaattctacattggaggtgtgtctgaa
gacgcaaggatgttcgcatctgtgctcagagtgaaggccaccgacagggacacgggtaat
tacagtgccatggcctaccggctcatcataccgccgattaaagagggcaaagaggggttt
gtggtggaaacatacacaggtctcatcaagacagccatgctcttccacaatatgagaaga
tcctacttcaagtttcaagtgattgcaactgacgactacgggaaggggttgagcgggaaa
gcagacgtactggtctccgtggtcaatcaactggatatgcaggtcattgtctccaatgtg
ccccctacactagtggaaaagaagatagaagaccttacagagattttggatcgctacgtt
caggagcaaattcctggtgccaaggttgtggtggagtccataggtgcccgtcgccatgga
gacgcctactccctagaagactatagcaagtgcgacctgactgtctatgccatcgacccg
cagaccaacagagccatcgacagaaatgagctttttaagttcctggacggcaaactgctc
gatatcaataaagacttccagccgtattacggggaaggagggcgcattctggagattcgg
acacctgaggcagtgacgagcatcaagaagcgaggagaaagcttggggtacacagaaggg
gccttgctggccttggccttcatcatcatcctctgttgcatcccagccatcttggtcgtc
ttagtaagctaccgacagtttaaagtacgccaggctgagtgcacgaagaccgcaagaatt
cagtctgctatgcctgcagccaagcctgcagctcctgtaccagctgcgcctgcgccgccc
ccgcccccgccaccaccaccaccaggagcacatctctatgaagaactgggagagagcgca
atgcataatcttttccttctctaccattttgaacaaagcaggggaaataactcagtccca
gaagacaggagcagtcatcgcgatgggatggccttttcctccagtaccactgagtctcat
gagccagctcatgtagagggaccacttaaggagagccagcctaacccagcaaggacgttc
tcatttgttcctgatgaggataacttaagtacccataatcccctttacatggaaagtata
ggtcaaaggtcaacaaactcagaccttcagccacgaacagattttgaagagctgttggca
cccagaacacaagttaagagtcagtctctgaggggcccaagagaaaagatccagagggtg
tggaatcagtctgtgagctttcctaggcggctcatgtggaaagccccaaacaggccagag
accatagacctggtggagtggcagatcaccaatcagagagctgaatgcgaaagcgccaga
tgccacccaagccagagaggtagcagcaacgttctgctggcaactgaagatgcccacgag
tcagagaaagaagggggacacagagacaccctaatcgtccagcaaacagagcagctgaaa
tctctgtcttctggctcttctttttcctcctcttggtctcacttttctttctcaactctg
ccaacgatttccagagcggtggaactcgggtcggaacctaatgtggtcacttctcccgct
gactgcaccttggaactttctcctcctctgagaccccgtattttaaactccttaagctct
aagagagagactcccacatgtgcatcagatacagaaccaaaaaggaactcttttgagatc
gctccccatccacctagcatctctgctcccctcccacatccgcctcttcctagacctccc
attgcctttaccacttttcctcttcccctttctccccctaaccctcctcccccacaactt
gttacattttctcttcccatttctacaccccctacttcttctctacctcttcctcctcca
ctgtcacttcctcctcctcctcggccaccagctccccgcctcttcccacagcctccttcc
acgtccattccatccacagacagcatctctgcaccagctgctaaatgcactgccagtgcc
acacacgccagagaaaccacgtctacgacacagccaccagcatccaacccgcagtggggg
gcagaaccccacagacatccaaaagggatcctcagacatgtgaaaaacttggcagagctc
gagaaatcagtgtctaacatgtacagtcacatagaaaaaaactgcccacctgcagatccc
tcaaaactacacacgttttgccctgcagagaaaacaggcatgaaaatcacacatgaccag
agccaggaaacgttggttagagttgttgagggaattgacgtgcaacctcacagtcaatca
acatctttgtaa

DBGET integrated database retrieval system