KEGG   Mus musculus (mouse): 11994Help
Entry
11994             CDS       T01002                                 

Gene name
Pcdh15, BB078305, Gm9815, Ush1f, av, nmf19
Definition
protocadherin 15
Orthology
K16500  
protocadherin-15
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10 B5.3; 10 37.43 cM
AA seq 1938 aa AA seqDB search
MFLQFAVWKCLPHGILIASLLVVSWGQYDDDCKLARGGPPATIVAIDEESRNGTILVDNM
LIKGTAGGPDPTIELSLKDNVDYWVLLDPVKQMLFLNSTGRVLDRDPPMNIHSIVVQVQC
VNKKVGTVIYHEVRIVVRDRNDNSPTFKHESYYATVNELTPVGTTIFTGFSGDNGATDID
DGPNGQIEYVIQYNPEDPTSNDTFEIPLMLTGNVVLRKRLNYEDKTRYYVIIQANDRAQN
LNERRTTTTTLTVDVLDGDDLGPMFLPCVLVPNTRDCRPLTYQAAIPELRTPEELNPILV
TPPIQAIDQDRNIQPPSDRPGILYSILVGTPEDYPRFFHMHPRTAELTLLEPVNRDFHQK
FDLVIKAEQDNGHPLPAFASLHIEILDENNQSPYFTMPSYQGYILESAPVGATISESLNL
TTPLRIVALDKDIEDTKDPELHLFLNDYTSVFTVTPTGITRYLTLLQPVDREEQQTYTFL
ITAFDGVQESEPVVVNIRVMDANDNTPTFPEISYDVYVYTDMSPGDSVIQLTAVDADEGS
NGEISYEILVGGKGDFVINKTTGLVSIAPGVELIVGQTYALTVQASDNAPPAERRHSICT
VYIEVLPPNNQSPPRFPQLMYSLEVSEAMRIGAILLNLQATDREGDPITYAIENGDPQRV
FNLSETTGILSLGKALDRESTDRYILIVTASDGRPDGTSTATVNIVVTDVNDNAPVFDPY
LPRNLSVVEEEANAFVGQVRATDPDAGINGQVHYSLGNFNNLFRITSNGSIYTAVKLNRE
ARDHYELVVVATDGAVHPRHSTLTLYIKVLDIDDNSPVFTNSTYTVVVEENLPAGTSFLQ
IEAKDVDLGANVSYRIRSPEVKHLFALHPFTGELSLLRSLDYEAFPDQEASITFLVEAFD
IYGTMPPGIATVTVIVKDMNDYPPVFSKRIYKGMVAPDAVKGTPITTVYAEDADPPGMPA
SRVRYRVDDVQFPYPASIFDVEEDSGRVVTRVNLNEEPTTIFKLVVVAFDDGEPVMSSSA
TVRILVLHPGEIPRFTQEEYRPPPVSELAARGTVVGVISAAAINQSIVYSIVAGNEEDKF
GINNVTGVIYVNSPLDYETRTSYVLRVQADSLEVVLANLRVPSKSNTAKVYIEIQDENDH
PPVFQKKFYIGGVSEDARMFASVLRVKATDRDTGNYSAMAYRLIIPPIKEGKEGFVVETY
TGLIKTAMLFHNMRRSYFKFQVIATDDYGKGLSGKADVLVSVVNQLDMQVIVSNVPPTLV
EKKIEDLTEILDRYVQEQIPGAKVVVESIGARRHGDAYSLEDYSKCDLTVYAIDPQTNRA
IDRNELFKFLDGKLLDINKDFQPYYGEGGRILEIRTPEAVTSIKKRGESLGYTEGALLAL
AFIIILCCIPAILVVLVSYRQFKVRQAECTKTARIQSAMPAAKPAAPVPAAPAPPPPPPP
PPPGAHLYEELGESAMHNLFLLYHFEQSRGNNSVPEDRSSHRDGMAFSSSTTESHEPAHV
EGPLKESQPNPARTFSFVPDEDNLSTHNPLYMESIGQRSTNSDLQPRTDFEELLAPRTQV
KSQSLRGPREKIQRVWNQSVSFPRRLMWKAPNRPETIDLVEWQITNQRAECESARCHPSQ
RGSSNVLLATEDAHESEKEGGHRDTLIVQQTEQLKSLSSGSSFSSSWSHFSFSTLPTISR
AVELGSEPNVVTSPADCTLELSPPLRPRILNSLSSKRETPTCASDTEPKRNSFEIAPHPP
SISAPLPHPPLPRPPIAFTTFPLPLSPPNPPPPQLVTFSLPISTPPTSSLPLPPPLSLPP
PPRPPAPRLFPQPPSTSIPSTDSISAPAAKCTASATHARETTSTTQPPASNPQWGAEPHR
HPKGILRHVKNLAELEKSVSNMYSHIEKNCPPADPSKLHTFCPAEKTGMKITHDQSQETL
VRVVEGIDVQPHSQSTSL
NT seq 5817 nt NT seq  +upstreamnt  +downstreamnt
atgttcctacagtttgctgtctggaagtgtttaccccatgggatcctcattgcctctctc
ttggtagtcagctggggccagtatgacgatgattgcaaactagctaggggaggaccacca
gctactatcgtggccattgatgaagagagtcgaaacggtacaattctggtggataacatg
ttgattaaggggactgccggaggaccagaccccaccatagagctctctttaaaggacaac
gtggactactgggtgttgctggaccccgttaaacagatgcttttcctgaacagtaccgga
agagttctggatagagacccaccaatgaacatacactccattgtggtgcaagtccagtgt
gtcaacaagaaggttggcacagttatctatcatgaagtacgcatcgtggtgcgagatcgg
aatgacaactcccccacattcaagcatgaaagctactatgccaccgtgaatgagctcact
ccagttggcaccacgatattcacggggttctcgggagacaatggagctacagacatagac
gatggccctaatggacagatagaatacgtgattcagtacaacccagaagatccgacatcc
aacgacacctttgaaattccactcatgctgactggcaacgtggtactgaggaaaagactc
aactatgaggataagactcgctactatgtcatcatccaagcaaatgaccgtgcacaaaat
ctgaatgagaggcgaacaaccaccaccaccctcacagtagatgttctagatggagatgac
ctgggacctatgtttctgccttgtgttcttgtgccaaacacacgtgactgtcgtccactc
acctaccaagctgccattcctgaactgaggactccggaagaactgaaccctattttggtg
acaccacctatccaagccattgatcaggaccgaaacatccaaccaccatctgatcgacct
ggcatcctctactccatccttgtcggcacccctgaggattacccccgcttcttccatatg
catcccaggactgcagaactcactctcctggagccagtaaacagagacttccatcaaaaa
tttgatttggttattaaggctgagcaggacaatggccacccacttcctgcctttgctagt
ctgcacatcgaaatactagacgaaaacaatcagagtccatacttcacaatgcccagctat
caaggatacatcctggaatccgccccagtgggagccaccatttctgagagcctaaactta
accactcctctgagaattgtagctctggacaaagacatagaagacacaaaagatccagag
ctccacctcttcctgaatgactacacctcggtcttcactgtgacacccactggtatcacc
cgctacctcaccctgcttcaacctgtggacagggaggaacagcaaacctacacctttctg
ataacagcgtttgatggcgtgcaagaaagtgagccagtcgtggtcaatatccgagtgatg
gatgcaaatgataacacgcccaccttccctgaaatctcctatgatgtctatgtttacaca
gacatgagtcctggggacagcgtcattcagctgacagcggtagatgctgatgaaggctct
aatggggagatctcctatgaaatactggtggggggcaagggagacttcgtgatcaacaag
accacagggctggtgagcattgcaccaggcgtggagctgatcgtgggacagacgtatgcg
ctcacagtgcaggcttcggacaacgccccgcctgcagaaagaaggcactccatctgcaca
gtgtacatcgaggtgcttcctcctaacaaccagagccctccccgcttcccgcagctgatg
tacagtctggaagtcagcgaggccatgaggatcggtgctattttattaaatctacaggca
actgatcgagagggagatccaatcacatatgccatcgagaatggagaccctcagagagtt
tttaatctttcagaaaccacagggattctcagcctagggaaggctctagaccgcgagagc
acagaccgctacatcctcatcgtcacagcctcagatggcagaccggatggaacctcaact
gccactgtgaacatagtggtgacggacgtcaatgacaacgctcccgtgttcgatccctat
ctgcccaggaacctctctgtggtggaggaagaagccaatgcctttgtgggtcaagtccgg
gcaacagacccagatgctgggataaacggccaagttcactacagcctggggaacttcaac
aacctcttccgcatcacatccaacgggagcatttacacagccgtgaagctgaacagggaa
gccagggaccactatgaactggttgtcgtggcaacagatggagcagtccaccctcgacat
tcaactctgacactgtacatcaaggtgttggacattgatgataacagtcctgtttttacc
aattcaacgtacacagttgtcgttgaagagaatctgccagccgggacctcctttcttcaa
atagaggccaaggatgttgaccttggagccaatgtgtcatatcggatcagaagcccagaa
gtgaaacacctttttgcactgcatccattcactggagaattgtctcttctgaggagtttg
gattatgaggcctttccggaccaggaggcaagcatcacattcttggtggaggcctttgac
atttatgggactatgccacctggtatagcaacagtcacggtaattgtgaaggacatgaat
gactaccctccagtgtttagcaaacgcatctacaaggggatggtggctccagatgcagtc
aaggggacaccaatcaccaccgtttatgctgaagatgcggacccacctgggatgcctgca
agtagggtgaggtatcgagtggacgacgtgcagtttccatacccagccagtatttttgat
gtagaggaagattctggaagagtagtaacccgcgtcaatcttaatgaagagcctactacg
attttcaagctggtggttgtggcttttgatgacggcgaacctgtgatgtccagcagtgcc
acggtgagaattcttgtcttacatcctggagagatcccacgcttcacccaagaggaatac
agacctcctcctgtaagtgagcttgcggccagagggactgtagttggtgtcatttctgct
gctgccattaatcagagcatcgtgtactccattgtggcaggaaatgaggaagacaagttt
ggaatcaacaatgtcactggggtcatctatgtgaattcaccattggattacgagacaagg
accagctatgtgctccgggtacaagcagattctctggaagtggtccttgccaatctccga
gtcccttcaaaaagcaatacagctaaggtgtacattgagattcaggatgaaaacgatcac
cccccagtgttccagaagaaattctacattggaggtgtgtctgaagacgcaaggatgttc
gcatctgtgctcagagtgaaggccaccgacagggacacgggtaattacagtgccatggcc
taccggctcatcataccgccgattaaagagggcaaagaggggtttgtggtggaaacatac
acaggtctcatcaagacagccatgctcttccacaatatgagaagatcctacttcaagttt
caagtgattgcaactgacgactacgggaaggggttgagcgggaaagcagacgtactggtc
tccgtggtcaatcaactggatatgcaggtcattgtctccaatgtgccccctacactagtg
gaaaagaagatagaagaccttacagagattttggatcgctacgttcaggagcaaattcct
ggtgccaaggttgtggtggagtccataggtgcccgtcgccatggagacgcctactcccta
gaagactatagcaagtgcgacctgactgtctatgccatcgacccgcagaccaacagagcc
atcgacagaaatgagctttttaagttcctggacggcaaactgctcgatatcaataaagac
ttccagccgtattacggggaaggagggcgcattctggagattcggacacctgaggcagtg
acgagcatcaagaagcgaggagaaagcttggggtacacagaaggggccttgctggccttg
gccttcatcatcatcctctgttgcatcccagccatcttggtcgtcttagtaagctaccga
cagtttaaagtacgccaggctgagtgcacgaagaccgcaagaattcagtctgctatgcct
gcagccaagcctgcagctcctgtaccagctgcgcctgcgccgcccccgcccccgccacca
ccaccaccaggagcacatctctatgaagaactgggagagagcgcaatgcataatcttttc
cttctctaccattttgaacaaagcaggggaaataactcagtcccagaagacaggagcagt
catcgcgatgggatggccttttcctccagtaccactgagtctcatgagccagctcatgta
gagggaccacttaaggagagccagcctaacccagcaaggacgttctcatttgttcctgat
gaggataacttaagtacccataatcccctttacatggaaagtataggtcaaaggtcaaca
aactcagaccttcagccacgaacagattttgaagagctgttggcacccagaacacaagtt
aagagtcagtctctgaggggcccaagagaaaagatccagagggtgtggaatcagtctgtg
agctttcctaggcggctcatgtggaaagccccaaacaggccagagaccatagacctggtg
gagtggcagatcaccaatcagagagctgaatgcgaaagcgccagatgccacccaagccag
agaggtagcagcaacgttctgctggcaactgaagatgcccacgagtcagagaaagaaggg
ggacacagagacaccctaatcgtccagcaaacagagcagctgaaatctctgtcttctggc
tcttctttttcctcctcttggtctcacttttctttctcaactctgccaacgatttccaga
gcggtggaactcgggtcggaacctaatgtggtcacttctcccgctgactgcaccttggaa
ctttctcctcctctgagaccccgtattttaaactccttaagctctaagagagagactccc
acatgtgcatcagatacagaaccaaaaaggaactcttttgagatcgctccccatccacct
agcatctctgctcccctcccacatccgcctcttcctagacctcccattgcctttaccact
tttcctcttcccctttctccccctaaccctcctcccccacaacttgttacattttctctt
cccatttctacaccccctacttcttctctacctcttcctcctccactgtcacttcctcct
cctcctcggccaccagctccccgcctcttcccacagcctccttccacgtccattccatcc
acagacagcatctctgcaccagctgctaaatgcactgccagtgccacacacgccagagaa
accacgtctacgacacagccaccagcatccaacccgcagtggggggcagaaccccacaga
catccaaaagggatcctcagacatgtgaaaaacttggcagagctcgagaaatcagtgtct
aacatgtacagtcacatagaaaaaaactgcccacctgcagatccctcaaaactacacacg
ttttgccctgcagagaaaacaggcatgaaaatcacacatgaccagagccaggaaacgttg
gttagagttgttgagggaattgacgtgcaacctcacagtcaatcaacatctttgtaa

DBGET integrated database retrieval system