KEGG   Mus musculus (mouse): 12006Help
Entry
12006             CDS       T01002                                 

Gene name
Axin2, Axi1, Axil, Conductin
Definition
(RefSeq) axin 2
  KO
K04385  
axin 2
Organism
mmu  Mus musculus (mouse)
Pathway
Wnt signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Pathways in cancer
Colorectal cancer
Endometrial cancer
Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    12006 (Axin2)
   04390 Hippo signaling pathway
    12006 (Axin2)
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    12006 (Axin2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    12006 (Axin2)
   05210 Colorectal cancer
    12006 (Axin2)
   05217 Basal cell carcinoma
    12006 (Axin2)
   05213 Endometrial cancer
    12006 (Axin2)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    12006 (Axin2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 E1; 11 71.83 cM
AA seq 840 aa AA seqDB search
MSSAVLVTLLPDPSSSFREDAPRPPVPGEEGETPPCQPSVGKVQSTKPMPVSSNARRNED
GLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQM
NLKDTKTLRVAKAIYKRYIENNSVVSKQLKPATKTYIRDGIKKQQIGSVMFDQAQTEIQA
VMEENAYQVFLTSDIYLEYVRSGGENTAYMSNGGLGSLKVLCGYLPTLNEEEEWTCADLK
CKLSPTVVGLSSKTLRATASVRSTETAENGFRSFKRSDPVNPYHVGSGYVFAPATSANDS
ELSSDALTDDSMSMTDSSVDGVPPYRMGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPK
EMTPVEPAAFAAELISRLEKLKLELESRHSLEERLQQIREDEEKEGSEQALSSRDGAPVQ
HPLALLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHHHQHHHHQQCH
TLLPTGGKLPPVAACPLLGGKSFLTKQTTKHVHHHYIHHHAVPKTKEEIEAEATQRVRCL
CPGGTDYYCYSKCKSHPKAPEPLPGEQFCGSRGGTLPKRNAKGTEPGLALSARDGGMSSA
AGAPQLPGEEGDRSQDVWQWMLESERQSKSKPHSAQSIRKSYPLESACAAPGERVSRHHL
LGASGHSRSVARAHPFTQDPAMPPLTPPNTLAQLEEACRRLAEVSKPQKQRCCVASQQRD
RNHSAAGQAGASPFANPSLAPEDHKEPKKLASVHALQASELVVTYFFCGEEIPYRRMLKA
QSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWDDETVLPMYEGRILGKVERID
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgccgtgttagtgactctccttccagatcccagcagcagcttccgcgaggat
gctccgcggcccccggttccgggagaagaaggggagaccccaccgtgtcagcctagtgtg
ggcaaggtccagtccaccaaacctatgcccgtttcctctaatgctaggcggaatgaagat
ggactgggggagcccgaggggcgggcctcccccgattcccctttgaccaggtggaccaag
tctttacactccttgttgggtgaccaggatggtgcatacctcttccggactttcctggag
agggagaaatgtgtggatacgctggacttctggtttgcttgtaatgggttcaggcagatg
aacctgaaggataccaaaactttgcgagtggccaaagcaatctataagaggtacattgag
aacaacagcgttgtctccaagcagctgaagcccgccaccaagacctacatacgagatggc
atcaagaagcaacagatcggctcggtcatgtttgaccaggcacagaccgagatccaggca
gtgatggaggaaaatgcctaccaggtgttcttgacttctgacatttacctggaatatgtg
aggagtgggggggaaaacacagcttacatgagtaacgggggactggggagcctaaaggtc
ttatgtggctacctccccaccttgaatgaagaagaggagtggacgtgtgccgacctcaag
tgcaaactctcacccaccgtggttggcttgtccagcaaaactcttcgggccaccgcgagt
gtgagatccacggaaacagctgaaaacggattcaggtccttcaagagaagcgacccagtc
aatccttatcacgtaggttccggctatgtctttgcaccagccaccagcgccaacgacagc
gagttatccagcgacgcactgaccgacgattccatgtccatgacggacagtagcgtagat
ggagtccctccttaccgcatggggagtaagaaacagctccagagagagatgcatcgcagt
gtgaaggccaatggccaagtgtctctacctcattttccgagaacccaccgcctgcccaag
gagatgacgcctgtggaacctgctgccttcgccgccgagctcatctccaggctggagaaa
ctgaaactggagctggaaagccgccatagtctggaggagcggctgcagcagatccgggag
gatgaagaaaaggaggggtctgagcaggccctgagctcacgggatggagcaccggtccag
caccccctggccctcctaccctccggcagctatgaagaggacccacaaaccattttggac
gaccacctctccagggtcctcaagacccccggctgtcaatcccctggtgtgggtcgctat
agcccacggtcccgctcccccgaccaccaccaccagcaccaccaccatcagcagtgtcat
acccttcttccgactgggggcaagctgccccccgtggctgcttgccccctccttggaggc
aagagcttcctgaccaaacagacgacgaagcacgttcaccaccactacatccaccaccac
gctgtccccaagaccaaggaggagatcgaggcagaagccacacagagagtccgctgcctc
tgtcctgggggaacagattattattgctactccaaatgcaaaagccacccaaaggctcca
gagcccctgcctggggagcagttttgtggcagcagaggtggtaccttgccaaaacggaat
gcaaagggcaccgaaccgggtcttgcactgtcggccagggatggagggatgtccagtgca
gcgggggccccccagcttcctggggaagaaggagaccggtcacaggatgtctggcagtgg
atgttagagagtgagcggcagagcaagtccaagccccatagtgcccaaagcataagaaag
agctacccattggagtctgcctgtgcggccccaggagaacgagtcagccggcaccatctg
ttgggggccagcggacactcccgctcggtggcccgggctcacccatttacccaggaccct
gcaatgcctccccttaccccacccaacactttggcacagctagaggaagcctgccgcagg
ctggcagaggtgtcgaagccccagaagcagcggtgctgcgtggccagtcagcagagggac
aggaaccactcggctgctggtcaggcaggagcctcacccttcgccaacccaagcctggct
ccagaagatcacaaagagccaaagaaactggcaagtgtccacgcgctccaggccagtgag
ctggttgtcacctactttttctgtggagaagaaattccatacaggaggatgctgaaggct
caaagcttgaccctgggccacttcaaggagcagctcagcaaaaagggaaattacaggtat
tatttcaagaaggcgagtgacgaatttgcctgcggagcagtttttgaggagatctgggac
gacgagacagtgctccccatgtacgaaggcaggatcctgggcaaagtggagaggatcgac
tga

DBGET integrated database retrieval system