KEGG   Mus musculus (mouse): 12041Help
Entry
12041             CDS       T01002                                 

Gene name
Bckdk, AI327402
Definition
branched chain ketoacid dehydrogenase kinase (EC:2.7.11.4)
Orthology
K00905  
[3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase [EC:2.7.11.4]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.4  [3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase
     12041 (Bckdk)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   12041 (Bckdk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 F3; 7
AA seq 412 aa AA seqDB search
MILTSVLGSGPRSWSSLWPLLGSSLSLRARSTSATDTHHVELARERSKTVTSFYNQSAID
VAAEKPSVRLTPTMMLYSGRSQDGSHLLKSGRYLQQELPVRIAHRIKGFRSLPFIIGCNP
TILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLDDHKDVVTLLAEGLRESRKHI
QDEKLVRYFLDKTLTSRLGIRMLATHHLALHEDKPDFVGIICTRLSPKKIIEKWVDFARR
LCEHKYGNAPRVRINGHVAARFPFIPMPLDYILPELLKNAMRATMESHLDTPYNVPDVVI
TIANNDIDLIIRISDRGGGIAHKDLDRVMDYHFTTAEASTQDPRINPLFGHLDMHSGGQS
GPMHGFGFGLPTSRAYAEYLGGSLQLQSLQGIGTDVYLRLRHIDGREESFRI
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgatactgacttcagtgctgggcagcggccctcggagctggtcttcactttggcccctc
ttggggtcctcactgtcactccgggctcgctcaacatcagccaccgatacacaccatgta
gagctggccagggaacgctccaagactgtcacctctttttacaaccagtcagccattgat
gtggcagcagagaagccctcagttcgcctcactcccaccatgatgctctattccggtcgc
tcacaggatggcagccaccttctgaaaagtggccgctacttgcagcaagagttaccagtg
aggattgctcaccgcatcaagggcttccgtagccttcctttcatcattggttgcaaccct
accatactgcatgtgcacgagctatacatccgggccttccagaagctgacagacttccct
ccgatcaaggaccaggcagatgaggcccagtactgccagctggtgagacagctgctagat
gaccacaaggatgtggtgaccctgttagctgagggtcttcgtgagagccggaaacacatc
caggatgaaaagctagtccggtacttcttggataaaacactgacgtcaagacttgggatc
cgaatgctggctactcaccacttggcgctacatgaagacaagcctgattttgttggcatc
atctgtactcgtctgtcgcccaagaagattatcgagaagtgggtggattttgccagacgc
ctgtgtgagcacaagtatggcaatgcccctcgagtccgcatcaacggacatgtggctgcc
cggttccccttcattcccatgccgctggactatatcctgcctgagctgctcaagaatgcc
atgagagccacaatggagagtcacctagacactccctacaatgtcccagatgtggtcatc
accatcgccaataatgatattgatctcatcatcaggatctcagaccggggtggaggaatc
gctcataaggacctggatcgggtcatggactaccacttcaccacagctgaggccagcacc
caggacccccgaatcaaccccctcttcggccacctggatatgcacagtggtggccagtca
ggacctatgcatggctttggcttcgggttgcccacgtccagggcatatgcagagtatctt
ggtggctccctgcagctgcagtccctgcagggcattggcacggatgtctacctacggctc
cgccacattgatggtcgggaggaaagcttcagaatctaa

DBGET integrated database retrieval system