KEGG   Mus musculus (mouse): 12043Help
Entry
12043             CDS       T01002                                 

Gene name
Bcl2, AW986256, Bcl-2, C430015F12Rik, D630044D05Rik, D830018M01Rik
Definition
(RefSeq) B cell leukemia/lymphoma 2
  KO
K02161  
apoptosis regulator Bcl-2
Organism
mmu  Mus musculus (mouse)
Pathway
EGFR tyrosine kinase inhibitor resistance
Platinum drug resistance
NF-kappa B signaling pathway
HIF-1 signaling pathway
Sphingolipid signaling pathway
Protein processing in endoplasmic reticulum
PI3K-Akt signaling pathway
Apoptosis
Apoptosis - multiple species
Adrenergic signaling in cardiomyocytes
Hedgehog signaling pathway
Focal adhesion
Jak-STAT signaling pathway
Neurotrophin signaling pathway
Cholinergic synapse
AGE-RAGE signaling pathway in diabetic complications
Amyotrophic lateral sclerosis (ALS)
Toxoplasmosis
Tuberculosis
Hepatitis B
Epstein-Barr virus infection
Pathways in cancer
MicroRNAs in cancer
Colorectal cancer
Prostate cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    12043 (Bcl2)
 Environmental Information Processing
  Signal transduction
   04340 Hedgehog signaling pathway
    12043 (Bcl2)
   04630 Jak-STAT signaling pathway
    12043 (Bcl2)
   04064 NF-kappa B signaling pathway
    12043 (Bcl2)
   04066 HIF-1 signaling pathway
    12043 (Bcl2)
   04071 Sphingolipid signaling pathway
    12043 (Bcl2)
   04151 PI3K-Akt signaling pathway
    12043 (Bcl2)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    12043 (Bcl2)
   04215 Apoptosis - multiple species
    12043 (Bcl2)
  Cellular commiunity
   04510 Focal adhesion
    12043 (Bcl2)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    12043 (Bcl2)
  Nervous system
   04725 Cholinergic synapse
    12043 (Bcl2)
   04722 Neurotrophin signaling pathway
    12043 (Bcl2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    12043 (Bcl2)
   05206 MicroRNAs in cancer
    12043 (Bcl2)
   05210 Colorectal cancer
    12043 (Bcl2)
   05215 Prostate cancer
    12043 (Bcl2)
   05222 Small cell lung cancer
    12043 (Bcl2)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    12043 (Bcl2)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    12043 (Bcl2)
  Infectious diseases
   05152 Tuberculosis
    12043 (Bcl2)
   05161 Hepatitis B
    12043 (Bcl2)
   05169 Epstein-Barr virus infection
    12043 (Bcl2)
   05145 Toxoplasmosis
    12043 (Bcl2)
  Antineoplastic resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    12043 (Bcl2)
   01524 Platinum drug resistance
    12043 (Bcl2)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     12043 (Bcl2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1 E2.1; 1 49.76 cM
AA seq 236 aa AA seqDB search
MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPA
VHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTP
FTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNR
HLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaagccgggagaacagggtatgataaccgggagatcgtgatgaagtacatacat
tataagctgtcacagaggggctacgagtgggatgctggagatgcggacgcggcgcccctg
ggggctgcccccacccctggcatcttctccttccagcctgagagcaacccaatgcccgct
gtgcaccgggacatggctgccaggacgtctcctctcaggcccctcgttgccaccgctggg
cctgcgctcagccctgtgccacctgtggtccatctgaccctccgccgggctggggatgac
ttctctcgtcgctaccgtcgtgacttcgcagagatgtccagtcagctgcacctgacgccc
ttcaccgcgaggggacgctttgccacggtggtggaggaactcttcagggatggggtgaac
tgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggagagcgtcaac
agggagatgtcacccctggtggacaacatcgccctgtggatgactgagtacctgaaccgg
catctgcacacctggatccaggataacggaggctgggatgcctttgtggaactatatggc
cccagcatgcgacctctgtttgatttctcctggctgtctctgaagaccctgctcagcctg
gccctggtcggggcctgcatcactctgggtgcatacctgggccacaagtga

DBGET integrated database retrieval system