KEGG   Mus musculus (mouse): 12048Help
Entry
12048             CDS       T01002                                 

Gene name
Bcl2l1, Bcl(X)L, Bcl-XL, Bcl2l, BclX, bcl-x, bcl2-L-1
Definition
(RefSeq) BCL2-like 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01524  Platinum drug resistance
mmu04014  Ras signaling pathway
mmu04064  NF-kappa B signaling pathway
mmu04137  Mitophagy - animal
mmu04140  Autophagy - animal
mmu04151  PI3K-Akt signaling pathway
mmu04210  Apoptosis
mmu04215  Apoptosis - multiple species
mmu04621  NOD-like receptor signaling pathway
mmu04630  Jak-STAT signaling pathway
mmu05014  Amyotrophic lateral sclerosis (ALS)
mmu05145  Toxoplasmosis
mmu05166  HTLV-I infection
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05212  Pancreatic cancer
mmu05220  Chronic myeloid leukemia
mmu05222  Small cell lung cancer
mmu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    12048 (Bcl2l1)
   04630 Jak-STAT signaling pathway
    12048 (Bcl2l1)
   04064 NF-kappa B signaling pathway
    12048 (Bcl2l1)
   04151 PI3K-Akt signaling pathway
    12048 (Bcl2l1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    12048 (Bcl2l1)
   04137 Mitophagy - animal
    12048 (Bcl2l1)
  Cell growth and death
   04210 Apoptosis
    12048 (Bcl2l1)
   04215 Apoptosis - multiple species
    12048 (Bcl2l1)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    12048 (Bcl2l1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    12048 (Bcl2l1)
   05202 Transcriptional misregulation in cancers
    12048 (Bcl2l1)
   05212 Pancreatic cancer
    12048 (Bcl2l1)
   05225 Hepatocellular carcinoma
    12048 (Bcl2l1)
   05220 Chronic myeloid leukemia
    12048 (Bcl2l1)
   05222 Small cell lung cancer
    12048 (Bcl2l1)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    12048 (Bcl2l1)
  Infectious diseases
   05166 HTLV-I infection
    12048 (Bcl2l1)
   05145 Toxoplasmosis
    12048 (Bcl2l1)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    12048 (Bcl2l1)
   01524 Platinum drug resistance
    12048 (Bcl2l1)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     12048 (Bcl2l1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    12048 (Bcl2l1)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   12048 (Bcl2l1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Motif
Other DBs
NCBI-GeneID: 12048
NCBI-ProteinID: NP_001276645
MGI: 88139
Ensembl: ENSMUSG00000007659
Vega: OTTMUSG00000015815
UniProt: Q64373 Q5HZH3
Structure
PDB: 

Jmol
Position
2 75.41 cM; 2 H1
AA seq 233 aa AA seqDB search
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEP
WIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagagcaaccgggagctggtggtcgactttctctcctacaagctttcccagaaa
ggatacagctggagtcagtttagtgatgtcgaagagaataggactgaggccccagaagaa
actgaagcagagagggagacccccagtgccatcaatggcaacccatcctggcacctggcg
gatagcccggccgtgaatggagccactggccacagcagcagtttggatgcgcgggaggtg
attcccatggcagcagtgaagcaagcgctgagagaggcaggcgatgagtttgaactgcgg
taccggagagcgttcagtgatctaacatcccagcttcacataaccccagggaccgcgtat
cagagctttgagcaggtagtgaatgaactctttcgggatggagtaaactggggtcgcatc
gtggcctttttctcctttggcggggcactgtgcgtggaaagcgtagacaaggagatgcag
gtattggtgagtcggattgcaagttggatggccacctatctgaatgaccacctagagcct
tggatccaggagaacggcggctgggacacttttgtggatctctacgggaacaatgcagca
gccgagagccggaaaggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg
gctggtgtggttctgctgggctcactcttcagtcggaagtga

DBGET integrated database retrieval system