KEGG   Mus musculus (mouse): 12050Help
Entry
12050             CDS       T01002                                 

Gene name
Bcl2l2, AW048834, Bcl-w, Gtrgal2, Gtrosa41, bclw, c98
Definition
(RefSeq) BCL2-like 2
  KO
K02163  
apoptosis regulator BCL-W
Organism
mmu  Mus musculus (mouse)
Pathway
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    12050 (Bcl2l2)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     12050 (Bcl2l2)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   12050 (Bcl2l2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
14 C3; 14 27.98 cM
AA seq 193 aa AA seqDB search
MATPASTPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRT
FSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVG
QVQDWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVAL
GALVTVGAFFASK
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccccagcctcaaccccagacacacgggctctagtggctgactttgtaggctat
aagctgaggcagaagggttatgtctgtggagctggccctggggaaggcccagccgccgac
ccgctgcaccaagccatgcgggctgctggagacgagtttgagacccgtttccgccgcacc
ttctctgacctggccgctcagctacacgtgaccccaggctcagcccagcaacgcttcacc
caggtttccgacgaacttttccaagggggccctaactggggccgtcttgtggcattcttt
gtctttggggctgccctgtgtgctgagagtgtcaacaaagaaatggagcctttggtggga
caagtgcaggattggatggtggcctacctggagacacgtctggctgactggatccacagc
agtgggggctgggcggagttcacagctctatacggggacggggccctggaggaggcacgg
cgtctgcgggaggggaactgggcatcagtgaggacagtgctgacgggggccgtggcactg
ggggccctggtaactgtaggggccttttttgctagcaagtga

DBGET integrated database retrieval system