KEGG   Mus musculus (mouse): 12064Help
Entry
12064             CDS       T01002                                 

Gene name
Bdnf
Definition
brain derived neurotrophic factor
Orthology
K04355  
brain-derived neurotrophic factor
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
cAMP signaling pathway
Neurotrophin signaling pathway
Huntington's disease
Cocaine addiction
Alcoholism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    12064 (Bdnf)
   04024 cAMP signaling pathway
    12064 (Bdnf)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    12064 (Bdnf)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    12064 (Bdnf)
  Substance dependence
   05030 Cocaine addiction
    12064 (Bdnf)
   05034 Alcoholism
    12064 (Bdnf)
Cytokines [BR:mmu04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass II
    12064 (Bdnf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 E3; 2 56.63 cM
AA seq 249 aa AA seqDB search
MTILFLTMVISYFGCMKAAPMKEVNVHGQGNLAYPGVRTHGTLESVNGPRAGSRGLTTTS
LADTFEHVIEELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLD
AANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLK
QYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCV
CTLTIKRGR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaccatccttttccttactatggttatttcatacttcggttgcatgaaggcggcgccc
atgaaagaagtaaacgtccacggacaaggcaacttggcctacccaggtgtgcggacccat
gggactctggagagcgtgaatgggcccagggcaggttcgagaggtctgacgacgacatca
ctggctgacacttttgagcacgtcatcgaagagctgctggatgaggaccagaaggttcgg
cccaacgaagaaaaccataaggacgcggacttgtacacttcccgggtgatgctcagcagt
caagtgcctttggagcctcctctactctttctgctggaggaatacaaaaattacctggat
gccgcaaacatgtctatgagggttcggcgccactccgaccctgcccgccgtggggagctg
agcgtgtgtgacagtattagcgagtgggtcacagcggcagataaaaagactgcagtggac
atgtctggcgggacggtcacagtcctagagaaagtcccggtatccaaaggccaactgaag
cagtatttctacgagaccaagtgtaatcccatgggttacaccaaggaaggctgcaggggc
atagacaaaaggcactggaactcgcaatgccgaactacccaatcgtatgttcgggccctt
actatggatagcaaaaagagaattggctggcgattcataaggatagacacttcctgtgta
tgtacactgaccattaaaaggggaagatag

DBGET integrated database retrieval system