KEGG   Mus musculus (mouse): 12064Help
Entry
12064             CDS       T01002                                 

Gene name
Bdnf
Definition
brain derived neurotrophic factor
Orthology
K04355  
brain-derived neurotrophic factor
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Neurotrophin signaling pathway
Huntington's disease
Cocaine addiction
Alcoholism
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:mmu04010]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:mmu04722]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:mmu05016]
Human Diseases; Substance dependence; Cocaine addiction [PATH:mmu05030]
Human Diseases; Substance dependence; Alcoholism [PATH:mmu05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 E3; 2 56.63 cM
AA seq 249 aa AA seqDB search
MTILFLTMVISYFGCMKAAPMKEVNVHGQGNLAYPGVRTHGTLESVNGPRAGSRGLTTTS
LADTFEHVIEELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLD
AANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLK
QYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCV
CTLTIKRGR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaccatccttttccttactatggttatttcatacttcggttgcatgaaggcggcgccc
atgaaagaagtaaacgtccacggacaaggcaacttggcctacccaggtgtgcggacccat
gggactctggagagcgtgaatgggcccagggcaggttcgagaggtctgacgacgacatca
ctggctgacacttttgagcacgtcatcgaagagctgctggatgaggaccagaaggttcgg
cccaacgaagaaaaccataaggacgcggacttgtacacttcccgggtgatgctcagcagt
caagtgcctttggagcctcctctactctttctgctggaggaatacaaaaattacctggat
gccgcaaacatgtctatgagggttcggcgccactccgaccctgcccgccgtggggagctg
agcgtgtgtgacagtattagcgagtgggtcacagcggcagataaaaagactgcagtggac
atgtctggcgggacggtcacagtcctagagaaagtcccggtatccaaaggccaactgaag
cagtatttctacgagaccaagtgtaatcccatgggttacaccaaggaaggctgcaggggc
atagacaaaaggcactggaactcgcaatgccgaactacccaatcgtatgttcgggccctt
actatggatagcaaaaagagaattggctggcgattcataaggatagacacttcctgtgta
tgtacactgaccattaaaaggggaagatag

DBGET integrated database retrieval system