KEGG   Mus musculus (mouse): 12064Help
Entry
12064             CDS       T01002                                 

Gene name
Bdnf
Definition
(RefSeq) brain derived neurotrophic factor
  KO
K04355  brain-derived neurotrophic factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04024  cAMP signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu05016  Huntington's disease
mmu05030  Cocaine addiction
mmu05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    12064 (Bdnf)
   04010 MAPK signaling pathway
    12064 (Bdnf)
   04024 cAMP signaling pathway
    12064 (Bdnf)
   04151 PI3K-Akt signaling pathway
    12064 (Bdnf)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    12064 (Bdnf)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    12064 (Bdnf)
  Substance dependence
   05030 Cocaine addiction
    12064 (Bdnf)
   05034 Alcoholism
    12064 (Bdnf)
Cytokines [BR:mmu04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass II
    12064 (Bdnf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NGF Spaetzle
Motif
Other DBs
NCBI-GeneID: 12064
NCBI-ProteinID: NP_001041604
MGI: 88145
Ensembl: ENSMUSG00000048482
Vega: OTTMUSG00000015122
UniProt: P21237 Q541P3
Position
2 E3; 2 56.63 cM
AA seq 249 aa AA seqDB search
MTILFLTMVISYFGCMKAAPMKEVNVHGQGNLAYPGVRTHGTLESVNGPRAGSRGLTTTS
LADTFEHVIEELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLD
AANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLK
QYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCV
CTLTIKRGR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaccatccttttccttactatggttatttcatacttcggttgcatgaaggcggcgccc
atgaaagaagtaaacgtccacggacaaggcaacttggcctacccaggtgtgcggacccat
gggactctggagagcgtgaatgggcccagggcaggttcgagaggtctgacgacgacatca
ctggctgacacttttgagcacgtcatcgaagagctgctggatgaggaccagaaggttcgg
cccaacgaagaaaaccataaggacgcggacttgtacacttcccgggtgatgctcagcagt
caagtgcctttggagcctcctctactctttctgctggaggaatacaaaaattacctggat
gccgcaaacatgtctatgagggttcggcgccactccgaccctgcccgccgtggggagctg
agcgtgtgtgacagtattagcgagtgggtcacagcggcagataaaaagactgcagtggac
atgtctggcgggacggtcacagtcctagagaaagtcccggtatccaaaggccaactgaag
cagtatttctacgagaccaagtgtaatcccatgggttacaccaaggaaggctgcaggggc
atagacaaaaggcactggaactcgcaatgccgaactacccaatcgtatgttcgggccctt
actatggatagcaaaaagagaattggctggcgattcataaggatagacacttcctgtgta
tgtacactgaccattaaaaggggaagatag

DBGET integrated database retrieval system