KEGG   Mus musculus (mouse): 12091Help
Entry
12091             CDS       T01002                                 

Gene name
Glb1, AW125515, Bge, Bgl, Bgl-e, Bgl-s, Bgl-t, Bgs, Bgt, C130097A14Rik
Definition
galactosidase, beta 1 (EC:3.2.1.23)
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
mmu  Mus musculus (mouse)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Module
Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    12091 (Glb1)
  Lipid metabolism
   00600 Sphingolipid metabolism
    12091 (Glb1)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    12091 (Glb1)
   00604 Glycosphingolipid biosynthesis - ganglio series
    12091 (Glb1)
   00511 Other glycan degradation
    12091 (Glb1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    12091 (Glb1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     12091 (Glb1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   12091 (Glb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
9 F3; 9 64.4 cM
AA seq 647 aa AA seqDB search
MLRVPLCTPLPLLALLQLLGAAHGIYNVTQRTFKLDYSRDRFLKDGQPFRYISGSIHYFR
IPRFYWEDRLLKMKMAGLNAIQMYVPWNFHEPQPGQYEFSGDRDVEHFIQLAHELGLLVI
LRPGPYICAEWDMGGLPAWLLEKQSIVLRSSDPDYLVAVDKWLAVLLPKMKPLLYQNGGP
IITVQVENEYGSYFACDYDYLRFLVHRFRYHLGNDVILFTTDGASEKMLKCGTLQDLYAT
VDFGTGNNITQAFLVQRKFEPKGPLINSEFYTGWLDHWGKPHSTVKTKTLATSLYNLLAR
GANVNLYMFIGGTNFAYWNGANTPYEPQPTSYDYDAPLSEAGDLTKKYFALREVIQMFKE
VPEGPIPPSTPKFAYGKVALRKFKTVAEALGILCPNGPVKSLYPLTFTQVKQYFGYVLYR
TTLPQDCSNPKPIFSSPFNGVRDRAYVSVDGVPQGILDRNLMTALNIRGKAGATLDILVE
NMGRVNYGRFINDFKGLISNMTINSTVLTNWTVFPLNTEAMVRNHLWGREASDEGHLDGR
STSNSSDLILPTFYVGNFSIPSGIPDLPQDTFIQFPGWSKGQVWINGFNLGRYWPTMGPQ
KTLFVPRNILTTSAPNNITVLELEFAPCSEGTPELCTVEFVDTPVIS
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgctccgggtccccctgtgtacgccgctcccgctcctggcactgctgcaactgctgggc
gctgcgcacggcatctataatgtcacccagaggacatttaagctcgactacagccgggac
cgcttcctcaaggatggacagccattccgatacatctcgggaagcattcattacttccgg
ataccccgcttctactgggaggaccggctgctgaagatgaagatggctgggctgaatgct
atccagatgtacgtgccctggaacttccatgaaccccaaccaggacaatatgagttttct
ggggaccgtgatgtggagcatttcatccagctggctcatgagctgggactcctggtgatc
ctgaggcctgggccctacatctgtgcagagtgggacatggggggcttacctgcttggcta
ctagagaaacaatctatcgttctccggtcttctgacccagactaccttgtagctgtggat
aaatggctggcagtccttctgcccaagatgaagcccctgctctaccagaacggaggaccg
atcataaccgtgcaggttgagaatgagtacgggtcctactttgcctgcgattacgactac
ctacgcttcctggtgcaccgcttccgctaccatctgggtaatgacgtcattctcttcacc
accgacggagcaagtgaaaaaatgctgaagtgtgggaccctgcaggacctgtacgccaca
gtggattttggaacaggcaacaatatcacacaagctttcctggtccagaggaagtttgaa
cctaaaggacctttgatcaattctgagttctatactggctggctagaccactggggtaaa
ccccattccacggtgaaaactaaaacactggctacctccctctataacctgcttgcccgt
ggggccaacgtgaacttgtacatgtttataggtgggaccaattttgcctattggaatggt
gccaacacgccctatgagccacagcccaccagctatgactacgacgccccactgagcgag
gctggggacctcactaagaagtattttgctcttcgagaagtcattcagatgtttaaagaa
gtcccagaaggccctatccctccgtctacacccaaatttgcatatggaaaagttgctctg
agaaagttcaagacagtggctgaagctctgggtatcctgtgtcccaatgggccagtgaaa
agcctctatcccctgacattcactcaggtaaaacagtattttgggtatgtgctgtaccga
acaacgcttcctcaagattgcagtaacccgaaacccattttctcttcacccttcaatggt
gtccgtgatcgggcttacgtctctgtggacggggtcccccaaggaatccttgatcgaaac
ctcatgacagctctgaacatacgggggaaggctggagccacgctggacatcctggtggag
aacatggggcgtgtgaactatggcagattcatcaatgacttcaagggtttgatttccaac
atgactatcaactccactgtcctcaccaactggacggtcttcccactgaacactgaggcc
atggtacgcaaccatctctggggccgggaggccagtgatgagggtcaccttgacggacgg
tcgacctccaattcttcggacctcatactccccaccttttacgtgggcaacttctccatc
ccctcgggcatcccagacctgccacaggacaccttcatccagtttcctgggtggtccaag
ggtcaagtatggatcaatggctttaacctcggccgatactggcccacaatgggcccacaa
aagaccttgttcgtgccaaggaacatcctgaccacttcagccccaaacaacatcacagtg
ttggagctagagtttgcaccctgcagcgaggggaccccagagctgtgtacagtagagttt
gttgacactccggtcatttcctga

DBGET integrated database retrieval system