KEGG   Mus musculus (mouse): 12095Help
Entry
12095             CDS       T01002                                 

Gene name
Bglap3, AI461847, Bglap-rs1, OC-X, ORG, mOC-X
Definition
(RefSeq) bone gamma-carboxyglutamate protein 3
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
3 F1; 3 38.81 cM
AA seq 95 aa AA seqDB search
MRTLSLLTLLALAALCLSDLTDATPTGPESDKAFMSKQEGNKVVNRLRRYLGASVPSPDP
LEPTRELCELDPACDELSNQYGLKTAYRRIYGITI
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgaggaccctctctctgctcactctgctggccctggctgcgctctgtctctctgacctc
acagatgccacgcccaccggccctgagtctgacaaagccttcatgtccaagcaggagggc
aataaggtagtgaacagactccggcgctaccttggagcttcagtccccagcccagatccc
ctggagcccacccgggagctatgtgagcttgaccctgcttgtgacgagctatcaaaccag
tatggcttaaagaccgcctacagacgcatctacggtatcactatttag

DBGET integrated database retrieval system