KEGG   Mus musculus (mouse): 12122Help
Entry
12122             CDS       T01002                                 

Gene name
Bid, 2700049M22Rik, AI875481, AU022477
Definition
(RefSeq) BH3 interacting domain death agonist
  KO
K04726  
BH3 interacting domain death agonist
Organism
mmu  Mus musculus (mouse)
Pathway
Sphingolipid signaling pathway
p53 signaling pathway
Apoptosis
Apoptosis - multiple species
Natural killer cell mediated cytotoxicity
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Amyotrophic lateral sclerosis (ALS)
Tuberculosis
Pathways in cancer
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04071 Sphingolipid signaling pathway
    12122 (Bid)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    12122 (Bid)
   04215 Apoptosis - multiple species
    12122 (Bid)
   04115 p53 signaling pathway
    12122 (Bid)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    12122 (Bid)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    12122 (Bid)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    12122 (Bid)
   05014 Amyotrophic lateral sclerosis (ALS)
    12122 (Bid)
  Cardiovascular diseases
   05416 Viral myocarditis
    12122 (Bid)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    12122 (Bid)
  Infectious diseases
   05152 Tuberculosis
    12122 (Bid)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6 F1; 6 57.02 cM
AA seq 195 aa AA seqDB search
MDSEVSNGSGLGAEHITDLLVFGFLQSSGCTRQELEVLGRELPVQAYWEADLEDELQTDG
SQASRSFNQGRIEPDSESQEEIIHNIARHLAQIGDEMDHNIQPTLVRQLAAQFMNGSLSE
EDKRNCLAKALDEVKTAFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFHTTVNFINQ
NLFSYVRNLVRNEMD
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggactctgaggtcagcaacggttccggcctgggggccgagcacatcacagacctgctg
gtgttcggctttctccaaagctctggctgtactcgccaagagctggaggtgctgggtcgg
gaactgcctgtgcaagcttactgggaggcagacctcgaagacgagctgcagacagatggc
agccaggccagccgctccttcaaccaaggaagaatagagccagattctgaaagtcaggaa
gaaatcatccacaacattgccagacatctcgcccaaataggcgatgagatggaccacaac
atccagcccacactggtgagacagctagccgcacagttcatgaatggcagcctgtcggag
gaagacaaaaggaactgcctggccaaagcccttgatgaggtgaagacagccttccccaga
gacatggagaacgacaaggccatgctgataatgaccatgctgttggccaaaaaagtggcc
agtcacgcaccatctttgctccgtgatgtcttccacacgactgtcaactttattaaccag
aacctattctcctatgtgaggaacttggttagaaacgagatggactga

DBGET integrated database retrieval system