KEGG   Mus musculus (mouse): 12143Help
Entry
12143             CDS       T01002                                 

Gene name
Blk
Definition
(RefSeq) B lymphoid kinase (EC:2.7.10.2)
  KO
K08890  
B lymphoid tyrosine kinase [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     12143 (Blk)
Protein kinases [BR:mmu01001]
 Tyrosine protein kinases
  Src family
   12143 (Blk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
14 D1; 14 33.25 cM
AA seq 499 aa AA seqDB search
MGLLSSKRQVSEKGKGWSPVKIRTQDKAPPPLPPLVVFNHLAPPSPNQDPDEEERFVVAL
FDYAAVNDRDLQVLKGEKLQVLRSTGDWWLARSLVTGREGYVPSNFVAPVETLEVEKWFF
RTISRKDAERQLLAPMNKAGSFLIRESESNKGAFSLSVKDITTQGEVVKHYKIRSLDNGG
YYISPRITFPTLQALVQHYSKKGDGLCQKLTLPCVNLAPKNLWAQDEWEIPRQSLKLVRK
LGSGQFGEVWMGYYKNNMKVAIKTLKEGTMSPEAFLGEANVMKTLQHERLVRLYAVVTRE
PIYIVTEYMARGCLLDFLKTDEGSRLSLPRLIDMSAQVAEGMAYIERMNSIHRDLRAANI
LVSETLCCKIADFGLARIIDSEYTAQEGAKFPIKWTAPEAIHFGVFTIKADVWSFGVLLM
EIVTYGRVPYPGMSNPEVIRSLEHGYRMPCPETCPPELYNDIITECWRGRPEERPTFEFL
QSVLEDFYTATEGQYELQP
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggggctgctgagcagcaagaggcaggtcagtgagaagggcaagggctggagccccgtg
aagatccgcacccaggacaaggctcccccacccctgccacccctggttgtcttcaaccac
cttgccccaccatctcctaaccaggacccagatgaagaggagcgttttgtggtggctctg
tttgactatgccgctgtgaatgacagggaccttcaggtgctgaagggtgagaagctccag
gtcttgaggagcactggagactggtggttggccaggtcactcgtcacaggaagagaaggt
tatgtgcccagcaactttgtggccccagtagagactctggaagtagaaaaatggttcttc
aggaccatcagccggaaggatgctgagaggcagttgctggctccgatgaacaaggccggc
tcctttctcatcagagagagtgagagcaataaaggtgccttttccctgtccgtgaaagat
atcaccacccagggggaggtggtcaagcactataagatccgatcactggacaatggaggc
tattacatctccccccggatcacctttcccaccctccaggccctggtgcagcactattca
aagaaaggggatggtttgtgtcagaagttgactctgccctgtgtgaacctggccccgaag
aacctttgggcccaagatgaatgggaaatccccaggcagtctctcaagttggtccggaaa
cttgggtctgggcagtttggcgaagtctggatgggttattacaaaaataacatgaaggtg
gccatcaagaccctgaaggagggaaccatgtcaccggaagctttcctgggcgaggccaac
gtgatgaaaaccctgcagcatgagaggctggttcgtctctacgctgtggtcaccagagag
cccatttacatcgtcactgaatacatggccagaggatgcttgctggattttctgaagacc
gatgaaggtagcaggttgtcccttccaaggctgattgacatgtcagcccaggttgcagag
gggatggcttacatagagcgcatgaattccatccaccgtgacctgcgggcagccaacatc
ctggtgtctgagacgttgtgctgcaaaatcgctgacttcggcttggccaggatcattgac
agtgaatacactgcccaagagggggccaagttccccatcaagtggaccgccccggaggcc
atccacttcggggtgtttaccatcaaggctgatgtgtggtccttcggagtcttgctgatg
gagattgtcacctatgggcgcgttccctacccaggaatgagcaaccctgaggtcatccgt
agcctggagcacggctaccgaatgccatgcccggagacatgtccaccggagttgtacaat
gatatcatcactgagtgctggcggggccggccagaggagcggcctacctttgagttcctg
cagtcggtgttggaggacttctacacagccacggagggccaatatgagctgcagccctag

DBGET integrated database retrieval system