KEGG   Mus musculus (mouse): 12168Help
Entry
12168             CDS       T01002                                 

Gene name
Bmpr2, 2610024H22Rik, AL117858, AW546137, BB189135, BMP-2, BMPR-2, BMPR-II, BMPRII, BRK-3, Gm20272
Definition
(RefSeq) bone morphogenetic protein receptor, type II (serine/threonine kinase) (EC:2.7.11.30)
  KO
K04671  
bone morphogenetic protein receptor type-2 [EC:2.7.11.30]
Organism
mmu  Mus musculus (mouse)
Pathway
Cytokine-cytokine receptor interaction
TGF-beta signaling pathway
Axon guidance
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
MicroRNAs in cancer
Module
BMP signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    12168 (Bmpr2)
   04390 Hippo signaling pathway
    12168 (Bmpr2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12168 (Bmpr2)
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    12168 (Bmpr2)
 Organismal Systems
  Development
   04360 Axon guidance
    12168 (Bmpr2)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    12168 (Bmpr2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     12168 (Bmpr2)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: TKL group
  TGFBR2 family [OT]
   12168 (Bmpr2)
Enzyme-linked receptors [BR:mmu01020]
 Receptor serine/threonine kinases
  Type II TGF-beta receptor
   12168 (Bmpr2)
Cytokine receptors [BR:mmu04050]
 TGF-beta receptors
  Type II TGF-beta receptor
   12168 (Bmpr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1; 1 C1.3
AA seq 1038 aa AA seqDB search
MTSSLHRPFRVPWLLWAVLLVSTTAASQNQERLCAFKDPYQQDLGIGESRISHENGTILC
SKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCST
DLCNVNFTENFPPPDTTPLSPPHSFNRDETIIIALASVSVLAVLIVALCFGYRMLTGDRK
QGLHSMNMMEAAAAEPSLDLDNLKLLELIGRGRYGAVYKGSLDERPVAVKVFSFANRQNF
INEKNIYRVPLMEHDNIARFIVGDERLTADGRMEYLLVMEYYPNGSLCKYLSLHTSDWVS
SCRLAHSVTRGLAYLHTELPRGDHYKPAISHRDLNSRNVLVKNDGACVISDFGLSMRLTG
NRLVRPGEEDNAAISEVGTIRYMAPEVLEGAVNLRDCESALKQVDMYALGLIYWEVFMRC
TDLFPGESVPDYQMAFQTEVGNHPTFEDMQVLVSREKQRPKFPEAWKENSLAVRSLKETI
EDCWDQDAEARLTAQCAEERMAELMMIWERNKSVSPTVNPMSTAMQNERNLSHNRRVPKI
GPYPDYSSSSYIEDSIHHTDSIVKNISSEHSMSSTPLTIGEKNRNSINYERQQAQARIPS
PETSVTSLSTNTTTTNTTGLTPSTGMTTISEMPYPDETHLHATNVAQSIGPTPVCLQLTE
EDLETNKLDPKEVDKNLKESSDENLMEHSLKQFSGPDPLSSTSSSLLYPLIKLAVEVTGQ
QDFTQAANGQACLIPDVPPAQIYPLPKQQNLPKRPTSLPLNTKNSTKEPRLKFGNKHKSN
LKQVETGVAKMNTINAAEPHVVTVTMNGVAGRSHNVNSHAATTQYANGAVPAGQAANIVA
HRSQEMLQNQFIGEDTRLNINSSPDEHEPLLRREQQAGHDEGVLDRLVDRRERPLEGGRT
NSNNNNSNPCSEQDILTQGVTSTAADPGPSKPRRAQRPNSLDLSATNILDGSSIQIGEST
QDGKSGSGEKIKRRVKTPYSLKRWRPSTWVISTEPLDCEVNNNGSDRAVHSKSSTAVYLA
EGGTATTTVSKDIGMNCL
NT seq 3117 nt NT seq  +upstreamnt  +downstreamnt
atgacttcctcgctgcatcggccctttcgggtgccctggctgctatgggccgtcctgctg
gtcagcactacggctgcttctcagaatcaagaacggctgtgtgcatttaaagatccatat
caacaagatcttgggataggtgagagtcgaatctctcatgaaaatgggacaatattatgt
tccaaagggagcacgtgttatggtctgtgggagaaatcaaaaggggacatcaatcttgtg
aaacaaggatgttggtctcacatcggtgatccccaagagtgccactatgaagagtgtgta
gtaactaccaccccaccctcaattcagaatggaacgtaccgcttttgctgctgtagtaca
gatttatgtaatgtcaactttactgagaactttccaccccctgacacaacaccactcagt
ccacctcattcatttaatcgagatgaaacgataatcattgctttggcatcagtttctgtg
ttagctgttttgatagtcgccttatgttttggatacagaatgttgacaggagaccggaaa
cagggtcttcacagcatgaacatgatggaggcggcagcagcagagccctcccttgacctg
gataacctgaagctgctggagctgattggacggggtcgatacggagcagtatataaaggt
tccttggatgagcgtccagttgctgtaaaagtattttcttttgcaaaccgtcagaatttt
ataaatgaaaaaaacatttacagagtgcctttgatggaacatgacaacattgctcgcttc
atagttggagacgagaggctcactgcagacggccgcatggagtatttgcttgtgatggag
tattatcccaatggatctctgtgcaaatatctgagtctccacacaagtgattgggtaagc
tcttgccgtctggctcattctgtgactagaggactggcttatcttcacacagaattacca
cgaggagatcattataaacccgcaatctcccaccgagatttaaacagcaggaatgtcctg
gtaaagaatgacggcgcgtgtgttatcagtgactttggtttatccatgaggctaactgga
aatcggctggtgcgcccaggggaagaagataatgcggctataagtgaggttggcacaatt
cgctatatggcaccagaagtgctagaaggagctgtgaacctgagggactgtgagtcagct
ctgaagcaagtggacatgtatgcgcttggactcatctactgggaggtgtttatgaggtgt
acagacctcttcccaggtgaatctgtaccagattaccagatggcttttcagacagaagtt
ggaaaccatcccacatttgaggatatgcaggttcttgtgtccagagagaagcagagaccc
aagttcccagaagcctggaaagaaaatagcctggcagtgaggtcactcaaggaaacaatt
gaagactgctgggaccaggatgcagaggctcggctcactgcacagtgtgctgaggagagg
atggctgaactcatgatgatatgggagagaaacaagtctgtgagcccaacggtcaaccca
atgtcaactgctatgcagaatgaacgcaacctgtcacataataggcgtgtgccaaaaatc
gggccttacccagattattcctcttcctcatatattgaagactctatccatcatactgac
agcattgtgaagaatatttcctctgagcattcgatgtccagcacaccattgacaatagga
gaaaagaatcgaaattcaattaattatgaacgacagcaagcacaagctcgaatccctagc
ccagaaacaagcgtcacaagcctgtccacaaacacaaccaccacaaacaccaccggcctc
actccaagtactggcatgaccactatatctgagatgccatacccagatgagacacatttg
cacgccacaaatgttgcacagtcaatcgggccaacccctgtctgcttacagctgacagaa
gaagacttggagactaataagctagatccaaaagaagttgataagaacctcaaggaaagc
tctgatgagaatctcatggagcattctctgaagcagttcagtgggccagacccattgagc
agtaccagttctagcttgctttatccactcataaagctcgcagtggaagtgactggacaa
caggacttcacacaggctgcaaatgggcaagcatgtttaattcctgatgttccacctgct
cagatctatcctctccctaagcaacagaaccttcctaagagacctactagtttgcctttg
aacaccaaaaattcaacaaaagaaccccggctaaaatttggcaacaagcacaaatcaaac
ttgaaacaagtagaaactggagttgccaagatgaatacaatcaatgcagcagagcctcat
gtggtgacagtaactatgaatggtgtggcaggtagaagccacaatgttaattcccatgct
gccacaacccagtatgccaatggcgcagtgccagctggccaggcagccaacatagtggca
cataggtcccaagaaatgctgcagaatcaatttattggtgaggataccaggctgaatatc
aattccagtcctgatgagcatgaacctttactgagacgagagcaacaggctggccatgat
gaaggggttctggatcgtttggtagataggagggaacggccattagaaggtggccgaaca
aattccaataacaacaacagcaatccatgttcagaacaagatatccttacacaaggtgtt
acaagcacagctgcagatcctgggccatcaaagcccagaagagcacagaggcccaattct
ctggatctttcagccacaaatatcctggatggcagcagtatacagataggtgagtcaaca
caagatggcaaatcaggatcaggtgaaaagatcaagagacgtgtgaaaactccatactct
cttaagcggtggcgcccgtccacctgggtcatctccaccgagccgctggactgtgaggtc
aacaacaatggcagtgacagggcagtccattctaaatctagcactgctgtgtaccttgca
gagggaggcactgccacgaccacagtgtctaaagatataggaatgaattgtctgtga

DBGET integrated database retrieval system