KEGG   Mus musculus (mouse): 12168Help
Entry
12168             CDS       T01002                                 

Gene name
Bmpr2, 2610024H22Rik, AL117858, AW546137, BB189135, BMP-2, BMPR-2, BMPR-II, BMPRII, BRK-3, Gm20272
Definition
(RefSeq) bone morphogenetic protein receptor, type II (serine/threonine kinase) (EC:2.7.11.30)
  KO
K04671  
bone morphogenetic protein receptor type-2 [EC:2.7.11.30]
Organism
mmu  Mus musculus (mouse)
Pathway
Cytokine-cytokine receptor interaction
TGF-beta signaling pathway
Axon guidance
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
MicroRNAs in cancer
Module
BMP signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    12168 (Bmpr2)
   04390 Hippo signaling pathway
    12168 (Bmpr2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12168 (Bmpr2)
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    12168 (Bmpr2)
 Organismal Systems
  Development
   04360 Axon guidance
    12168 (Bmpr2)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    12168 (Bmpr2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     12168 (Bmpr2)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: TKL group
  TGFBR2 family [OT]
   12168 (Bmpr2)
Enzyme-linked receptors [BR:mmu01020]
 Receptor serine/threonine kinases
  Type II TGF-beta receptor
   12168 (Bmpr2)
Cytokine receptors [BR:mmu04050]
 TGF-beta receptors
  Type II TGF-beta receptor
   12168 (Bmpr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1; 1 C1.3
AA seq 1038 aa AA seqDB search
MTSSLHRPFRVPWLLWAVLLVSTTAASQNQERLCAFKDPYQQDLGIGESRISHENGTILC
SKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCST
DLCNVNFTENFPPPDTTPLSPPHSFNRDETIIIALASVSVLAVLIVALCFGYRMLTGDRK
QGLHSMNMMEAAAAEPSLDLDNLKLLELIGRGRYGAVYKGSLDERPVAVKVFSFANRQNF
INEKNIYRVPLMEHDNIARFIVGDERLTADGRMEYLLVMEYYPNGSLCKYLSLHTSDWVS
SCRLAHSVTRGLAYLHTELPRGDHYKPAISHRDLNSRNVLVKNDGACVISDFGLSMRLTG
NRLVRPGEEDNAAISEVGTIRYMAPEVLEGAVNLRDCESALKQVDMYALGLIYWEVFMRC
TDLFPGESVPDYQMAFQTEVGNHPTFEDMQVLVSREKQRPKFPEAWKENSLAVRSLKETI
EDCWDQDAEARLTAQCAEERMAELMMIWERNKSVSPTVNPMSTAMQNERNLSHNRRVPKI
GPYPDYSSSSYIEDSIHHTDSIVKNISSEHSMSSTPLTIGEKNRNSINYERQQAQARIPS
PETSVTSLSTNTTTTNTTGLTPSTGMTTISEMPYPDETHLHATNVAQSIGPTPVCLQLTE
EDLETNKLDPKEVDKNLKESSDENLMEHSLKQFSGPDPLSSTSSSLLYPLIKLAVEVTGQ
QDFTQAANGQACLIPDVPPAQIYPLPKQQNLPKRPTSLPLNTKNSTKEPRLKFGNKHKSN
LKQVETGVAKMNTINAAEPHVVTVTMNGVAGRSHNVNSHAATTQYANGAVPAGQAANIVA
HRSQEMLQNQFIGEDTRLNINSSPDEHEPLLRREQQAGHDEGVLDRLVDRRERPLEGGRT
NSNNNNSNPCSEQDILTQGVTSTAADPGPSKPRRAQRPNSLDLSATNILDGSSIQIGEST
QDGKSGSGEKIKRRVKTPYSLKRWRPSTWVISTEPLDCEVNNNGSDRAVHSKSSTAVYLA
EGGTATTTVSKDIGMNCL
NT seq 3117 nt NT seq  +upstreamnt  +downstreamnt
atgacttcctcgctgcatcggccctttcgggtgccctggctgctatgggccgtcctgctg
gtcagcactacggctgcttctcagaatcaagaacggctgtgtgcatttaaagatccatat
caacaagatcttgggataggtgagagtcgaatctctcatgaaaatgggacaatattatgt
tccaaagggagcacgtgttatggtctgtgggagaaatcaaaaggggacatcaatcttgtg
aaacaaggatgttggtctcacatcggtgatccccaagagtgccactatgaagagtgtgta
gtaactaccaccccaccctcaattcagaatggaacgtaccgcttttgctgctgtagtaca
gatttatgtaatgtcaactttactgagaactttccaccccctgacacaacaccactcagt
ccacctcattcatttaatcgagatgaaacgataatcattgctttggcatcagtttctgtg
ttagctgttttgatagtcgccttatgttttggatacagaatgttgacaggagaccggaaa
cagggtcttcacagcatgaacatgatggaggcggcagcagcagagccctcccttgacctg
gataacctgaagctgctggagctgattggacggggtcgatacggagcagtatataaaggt
tccttggatgagcgtccagttgctgtaaaagtattttcttttgcaaaccgtcagaatttt
ataaatgaaaaaaacatttacagagtgcctttgatggaacatgacaacattgctcgcttc
atagttggagacgagaggctcactgcagacggccgcatggagtatttgcttgtgatggag
tattatcccaatggatctctgtgcaaatatctgagtctccacacaagtgattgggtaagc
tcttgccgtctggctcattctgtgactagaggactggcttatcttcacacagaattacca
cgaggagatcattataaacccgcaatctcccaccgagatttaaacagcaggaatgtcctg
gtaaagaatgacggcgcgtgtgttatcagtgactttggtttatccatgaggctaactgga
aatcggctggtgcgcccaggggaagaagataatgcggctataagtgaggttggcacaatt
cgctatatggcaccagaagtgctagaaggagctgtgaacctgagggactgtgagtcagct
ctgaagcaagtggacatgtatgcgcttggactcatctactgggaggtgtttatgaggtgt
acagacctcttcccaggtgaatctgtaccagattaccagatggcttttcagacagaagtt
ggaaaccatcccacatttgaggatatgcaggttcttgtgtccagagagaagcagagaccc
aagttcccagaagcctggaaagaaaatagcctggcagtgaggtcactcaaggaaacaatt
gaagactgctgggaccaggatgcagaggctcggctcactgcacagtgtgctgaggagagg
atggctgaactcatgatgatatgggagagaaacaagtctgtgagcccaacggtcaaccca
atgtcaactgctatgcagaatgaacgcaacctgtcacataataggcgtgtgccaaaaatc
gggccttacccagattattcctcttcctcatatattgaagactctatccatcatactgac
agcattgtgaagaatatttcctctgagcattcgatgtccagcacaccattgacaatagga
gaaaagaatcgaaattcaattaattatgaacgacagcaagcacaagctcgaatccctagc
ccagaaacaagcgtcacaagcctgtccacaaacacaaccaccacaaacaccaccggcctc
actccaagtactggcatgaccactatatctgagatgccatacccagatgagacacatttg
cacgccacaaatgttgcacagtcaatcgggccaacccctgtctgcttacagctgacagaa
gaagacttggagactaataagctagatccaaaagaagttgataagaacctcaaggaaagc
tctgatgagaatctcatggagcattctctgaagcagttcagtgggccagacccattgagc
agtaccagttctagcttgctttatccactcataaagctcgcagtggaagtgactggacaa
caggacttcacacaggctgcaaatgggcaagcatgtttaattcctgatgttccacctgct
cagatctatcctctccctaagcaacagaaccttcctaagagacctactagtttgcctttg
aacaccaaaaattcaacaaaagaaccccggctaaaatttggcaacaagcacaaatcaaac
ttgaaacaagtagaaactggagttgccaagatgaatacaatcaatgcagcagagcctcat
gtggtgacagtaactatgaatggtgtggcaggtagaagccacaatgttaattcccatgct
gccacaacccagtatgccaatggcgcagtgccagctggccaggcagccaacatagtggca
cataggtcccaagaaatgctgcagaatcaatttattggtgaggataccaggctgaatatc
aattccagtcctgatgagcatgaacctttactgagacgagagcaacaggctggccatgat
gaaggggttctggatcgtttggtagataggagggaacggccattagaaggtggccgaaca
aattccaataacaacaacagcaatccatgttcagaacaagatatccttacacaaggtgtt
acaagcacagctgcagatcctgggccatcaaagcccagaagagcacagaggcccaattct
ctggatctttcagccacaaatatcctggatggcagcagtatacagataggtgagtcaaca
caagatggcaaatcaggatcaggtgaaaagatcaagagacgtgtgaaaactccatactct
cttaagcggtggcgcccgtccacctgggtcatctccaccgagccgctggactgtgaggtc
aacaacaatggcagtgacagggcagtccattctaaatctagcactgctgtgtaccttgca
gagggaggcactgccacgaccacagtgtctaaagatataggaatgaattgtctgtga

DBGET integrated database retrieval system