KEGG   Mus musculus (mouse): 12169Help
Entry
12169             CDS       T01002                                 

Gene name
Bmx, Etk, Etk/Bmx, Tyro8
Definition
(RefSeq) BMX non-receptor tyrosine kinase (EC:2.7.10.2)
  KO
K08896  
cytoplasmic tyrosine-protein kinase BMX [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     12169 (Bmx)
Protein kinases [BR:mmu01001]
 Tyrosine protein kinases
  Tec family [OT]
   12169 (Bmx)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
X; X F
AA seq 655 aa AA seqDB search
MDDNMESKSILEELLLKKSQQKKKMSPNNYKERLFVLTKTSLSYYEYDKMKRGSRKGSIE
IKKIRCVEKVNLEEQTPVERQYPFQIVYKDGLLYVYASNEESRCQWLKALQKEIRGNPHL
LIKYHSGFFVDGKFLCCQQSCKAAPGCTLWEAYADLHIAISDEKHRAPTFPERLLKIPRA
VPVLKMDASSSGAILPQYDSYSKKSCGSQPTSNIRYIPREDCPDWWQVRKLKSEEDIACS
NQLERNIASHSTSKMSWGFPESSSSEEEENLHAYDWFAGNISRSQSEQLLRQKGKEGAFM
VRNSSQMGMYTVSLFSKAVNDKKGTVKHYHVHTNAENKLYLAENYCFDSIPKLIHYHQHN
SAGMITRLRHPVSTKANKVPVSVALGSGIWELKREEITLLKELGNGQFGVVQLGQWKGQY
DVAVKMIKEGAMSEDEFFQEAQTMMKLSHPKLVKFYGVCSKKYPIYIVTEYITNGCLLNY
LKSHGKGLESCQLLEMCYDVCEGMAFLESHQFIHRDLAARNCLVDSDLSVKVSDFGMTRY
VLDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGILMWEVFSLGKQPYDLYDNSE
VVVKVSQGHRLYRPQLASDTIYQIMYSCWHELPEKRPTFQQLLSAIEPLREQDKP
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggacgacaatatggagagtaaatccattctggaagaactgcttctcaaaaagtcacag
caaaagaagaaaatgtcaccaaataattacaaggagcggctttttgttctaaccaaaaca
agcctttcctactatgaatacgacaaaatgaaaagaggaagcagaaaaggatcaatagaa
attaagaaaatcagatgtgtggaaaaagtcaaccttgaggagcagacaccggtggagaga
cagtacccatttcagattgtgtataaagatgggcttctttatgtctatgcatcgaatgaa
gagagccgatgtcagtggttaaaagcgctgcaaaaagagatacggggcaaccctcacctg
ttgatcaagtatcacagtggcttctttgtggatggaaagttcctgtgttgccagcagagc
tgcaaagcagccccaggatgcactctctgggaagcatatgctgatctgcacatcgcaatc
agtgatgagaaacacagagctcccactttcccagagaggctactgaagattccaagggca
gttcccgttctcaaaatggatgcatcatcttcaggtgccattctaccccaatatgacagc
tattcaaagaaaagttgtggttcccagccaaccagcaacatacgctatattccaagggaa
gactgccctgactggtggcaagtaagaaaactgaaaagcgaggaagacattgcatgcagt
aaccaactggaaagaaatatcgcctctcacagcacctcaaagatgtcatggggattccct
gagtcaagttcatcagaagaagaggaaaatctgcatgcttatgactggtttgctgggaat
atctccaggtcacaatctgagcagttactgagacaaaagggaaaagaaggagcatttatg
gttcggaattccagccagatgggaatgtacactgtgtccttatttagtaaggctgtaaat
gataaaaaaggaactgtcaagcattaccacgtgcatactaatgctgaaaataaattatac
ctggctgaaaactactgctttgattccattccaaagctcattcactatcaccaacataat
tcagcaggcatgatcacacggctccgccacccagtgtcaaccaaggccaacaaggtcccg
gtgtctgtggctctgggaagtggaatttgggaactgaaaagagaagagattaccttgctg
aaggagctgggcaatggccagtttggagtggtccagctgggccagtggaaggggcaatat
gatgtggctgtaaagatgatcaaggagggtgccatgtcagaagatgaattctttcaggag
gcccagaccatgatgaaactcagccatcccaagctggtgaagttctacggagtatgctca
aagaaataccccatctatatagtaactgagtatataacaaatggttgcttgcttaattac
ctgaagagtcatgggaaaggactagaaagttgccagctcttagaaatgtgttatgatgtc
tgtgaaggcatggccttcttggagagccatcagttcatacatcgagatttggctgctcgg
aactgtttggtggacagtgatctctctgtgaaagtctcagactttggaatgacgagatat
gtccttgatgatcagtatgtcagctcagtaggaaccaagtttccagtcaagtggtcagct
ccagaggtgtttcactacttcaaatacagcagcaagtcggatgtatgggcatttgggatc
ctgatgtgggaggtgtttagtctagggaagcagccctatgacttatatgataactccgag
gtggttgtgaaggtctcccagggccacagactctaccggccccaactggcatcagacacc
atctaccagatcatgtacagctgctggcatgagcttccagaaaagcgccccacatttcag
caactcctgtctgccatagaaccacttcgggaacaagataaaccatga

DBGET integrated database retrieval system