KEGG   Mus musculus (mouse): 12229Help
Entry
12229             CDS       T01002                                 

Gene name
Btk, AI528679, xid
Definition
Bruton agammaglobulinemia tyrosine kinase (EC:2.7.10.2)
Orthology
K07370  
Bruton agammaglobulinemia tyrosine kinase [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Pathway
NF-kappa B signaling pathway
Osteoclast differentiation
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Primary immunodeficiency
Class
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:mmu04064]
Organismal Systems; Immune system; B cell receptor signaling pathway [PATH:mmu04662]
Organismal Systems; Immune system; Fc epsilon RI signaling pathway [PATH:mmu04664]
Organismal Systems; Development; Osteoclast differentiation [PATH:mmu04380]
Human Diseases; Immune diseases; Primary immunodeficiency [PATH:mmu05340]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
X E3; X 56.18 cM
AA seq 659 aa AA seqDB search
MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEK
ITCVETVIPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEEL
RKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSS
HRKTKKPLPPTPEEDQILKKPLPPEPTAAPISTTELKKVVALYDYMPMNANDLQLRKGEE
YFILEESNLPWWRARDKNGQEGYIPSNYITEAEDSIEMYEWYSKHMTRSQAEQLLKQEGK
EGGFIVRDSSKAGKYTVSVFAKSTGEPQGVIRHYVVCSTPQSQYYLAEKHLFSTIPELIN
YHQHNSAGLISRLKYPVSKQNKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGK
WRGQYDVAIKMIREGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANG
CLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDF
GLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYER
FTNSETAEHIAQGLRLYRPHLASERVYTIMYSCWHEKADERPSFKILLSNILDVMDEES
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagtgatactggagagcatctttctgaagcgctcccagcagaaaaagaaaaca
tcacctttaaacttcaagaagcgcctgtttctcttgactgtacacaaactttcatactat
gaatatgactttgaacgtgggagaagaggcagtaagaaaggttcaatagatgttgagaag
atcacctgtgttgaaacagtaattcctgaaaaaaatcccccaccagaaagacagattccg
aggagaggtgaggagtctagtgaaatggaacagatttcaatcattgaaaggttcccgtac
ccattccaggttgtatatgatgaaggacctctctatgttttctccccaactgaagagctg
agaaagcgctggattcaccagctcaaaaatgtaatccggtacaatagtgacctggtacag
aaataccatccttgcttctggattgatggacagtatctctgctgctctcagacagccaag
aatgctatgggctgccaaattttggagaacaggaatggaagcttaaaacctgggagttct
catcgaaaaacgaaaaagcctcttccccctaccccagaggaagatcagatcttgaaaaaa
ccgcttcccccggagccaacagcagcaccaatctccacaaccgagctgaaaaaggtcgtg
gccctttatgattacatgccaatgaacgcaaatgacttacaattgcgaaagggcgaggag
tattttatcctggaggagagcaacctaccgtggtggcgagcacgagataaaaatgggcag
gaaggctacatcccaagtaactatatcactgaagctgaggactccatagagatgtatgag
tggtattccaagcacatgactcgaagtcaagctgagcaactgctaaagcaagaggggaaa
gaaggaggtttcattgtcagagactccagcaaagctggaaaatacaccgtgtctgtgttt
gctaaatctactggggagcctcaaggggtgatccgccattacgttgtgtgttccacgcca
cagagccagtattacctggctgagaaacacctcttcagcaccatccctgagctcattaac
taccatcaacacaactctgcaggcctcatatccaggctgaaatatcctgtgtctaaacaa
aacaaaaacgcgccttctactgcaggcctgggctatggatcatgggaaattgatccaaag
gacctcaccttcttgaaggagcttgggactggacaattcggtgtcgtgaaatatgggaag
tggaggggccaatatgatgtggccatcaagatgatcagagaaggttccatgtcggaggat
gaattcattgaagaagccaaagtcatgatgaatctttcccatgagaagctggtgcagttg
tatggcgtctgcaccaaacaacgccccatcttcatcatcaccgagtacatggctaatggc
tgcctcttgaactacctgagggagatgcggcaccgcttccagacacagcagctgcttgag
atgtgcaaagatgtctgtgaagcaatggaatacttggagtcgaagcagttccttcacaga
gacctggcagctcgaaactgtttggtaaacgatcaaggagttgtgaaagtatctgacttt
ggcctgtctaggtatgtccttgatgatgagtacaccagctctgtaggctccaagtttcca
gtccggtggtctccaccagaagtgcttatgtatagcaagttcagcagcaaatctgacatc
tgggcttttggggttttaatgtgggagatctactccctggggaagatgccgtatgagaga
tttactaacagtgagacagcagaacacattgctcaaggcttacgtctctacaggcctcat
ctggcatcagagagggtatataccatcatgtacagctgctggcacgagaaagcagatgaa
cgtcctagtttcaaaattctcttgagtaacattctagatgtgatggatgaagaatcctga

DBGET integrated database retrieval system