KEGG   Mus musculus (mouse): 12229Help
Entry
12229             CDS       T01002                                 

Gene name
Btk, AI528679, xid
Definition
Bruton agammaglobulinemia tyrosine kinase (EC:2.7.10.2)
Orthology
K07370  
Bruton agammaglobulinemia tyrosine kinase [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Pathway
NF-kappa B signaling pathway
Osteoclast differentiation
Platelet activation
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    12229 (Btk)
 Organismal Systems
  Immune system
   04611 Platelet activation
    12229 (Btk)
   04662 B cell receptor signaling pathway
    12229 (Btk)
   04664 Fc epsilon RI signaling pathway
    12229 (Btk)
  Development
   04380 Osteoclast differentiation
    12229 (Btk)
 Human Diseases
  Immune diseases
   05340 Primary immunodeficiency
    12229 (Btk)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     12229 (Btk)
Protein kinases [BR:mmu01001]
 Tyrosine protein kinases
  Tec family [OT]
   12229 (Btk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
X E3; X 56.18 cM
AA seq 659 aa AA seqDB search
MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEK
ITCVETVIPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEEL
RKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSS
HRKTKKPLPPTPEEDQILKKPLPPEPTAAPISTTELKKVVALYDYMPMNANDLQLRKGEE
YFILEESNLPWWRARDKNGQEGYIPSNYITEAEDSIEMYEWYSKHMTRSQAEQLLKQEGK
EGGFIVRDSSKAGKYTVSVFAKSTGEPQGVIRHYVVCSTPQSQYYLAEKHLFSTIPELIN
YHQHNSAGLISRLKYPVSKQNKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGK
WRGQYDVAIKMIREGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANG
CLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDF
GLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYER
FTNSETAEHIAQGLRLYRPHLASERVYTIMYSCWHEKADERPSFKILLSNILDVMDEES
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagtgatactggagagcatctttctgaagcgctcccagcagaaaaagaaaaca
tcacctttaaacttcaagaagcgcctgtttctcttgactgtacacaaactttcatactat
gaatatgactttgaacgtgggagaagaggcagtaagaaaggttcaatagatgttgagaag
atcacctgtgttgaaacagtaattcctgaaaaaaatcccccaccagaaagacagattccg
aggagaggtgaggagtctagtgaaatggaacagatttcaatcattgaaaggttcccgtac
ccattccaggttgtatatgatgaaggacctctctatgttttctccccaactgaagagctg
agaaagcgctggattcaccagctcaaaaatgtaatccggtacaatagtgacctggtacag
aaataccatccttgcttctggattgatggacagtatctctgctgctctcagacagccaag
aatgctatgggctgccaaattttggagaacaggaatggaagcttaaaacctgggagttct
catcgaaaaacgaaaaagcctcttccccctaccccagaggaagatcagatcttgaaaaaa
ccgcttcccccggagccaacagcagcaccaatctccacaaccgagctgaaaaaggtcgtg
gccctttatgattacatgccaatgaacgcaaatgacttacaattgcgaaagggcgaggag
tattttatcctggaggagagcaacctaccgtggtggcgagcacgagataaaaatgggcag
gaaggctacatcccaagtaactatatcactgaagctgaggactccatagagatgtatgag
tggtattccaagcacatgactcgaagtcaagctgagcaactgctaaagcaagaggggaaa
gaaggaggtttcattgtcagagactccagcaaagctggaaaatacaccgtgtctgtgttt
gctaaatctactggggagcctcaaggggtgatccgccattacgttgtgtgttccacgcca
cagagccagtattacctggctgagaaacacctcttcagcaccatccctgagctcattaac
taccatcaacacaactctgcaggcctcatatccaggctgaaatatcctgtgtctaaacaa
aacaaaaacgcgccttctactgcaggcctgggctatggatcatgggaaattgatccaaag
gacctcaccttcttgaaggagcttgggactggacaattcggtgtcgtgaaatatgggaag
tggaggggccaatatgatgtggccatcaagatgatcagagaaggttccatgtcggaggat
gaattcattgaagaagccaaagtcatgatgaatctttcccatgagaagctggtgcagttg
tatggcgtctgcaccaaacaacgccccatcttcatcatcaccgagtacatggctaatggc
tgcctcttgaactacctgagggagatgcggcaccgcttccagacacagcagctgcttgag
atgtgcaaagatgtctgtgaagcaatggaatacttggagtcgaagcagttccttcacaga
gacctggcagctcgaaactgtttggtaaacgatcaaggagttgtgaaagtatctgacttt
ggcctgtctaggtatgtccttgatgatgagtacaccagctctgtaggctccaagtttcca
gtccggtggtctccaccagaagtgcttatgtatagcaagttcagcagcaaatctgacatc
tgggcttttggggttttaatgtgggagatctactccctggggaagatgccgtatgagaga
tttactaacagtgagacagcagaacacattgctcaaggcttacgtctctacaggcctcat
ctggcatcagagagggtatataccatcatgtacagctgctggcacgagaaagcagatgaa
cgtcctagtttcaaaattctcttgagtaacattctagatgtgatggatgaagaatcctga

DBGET integrated database retrieval system