KEGG   Mus musculus (mouse): 12236Help
Entry
12236             CDS       T01002                                 

Gene name
Bub1b, AU045529, BUBR1
Definition
(RefSeq) BUB1B, mitotic checkpoint serine/threonine kinase (EC:2.7.11.1)
  KO
K06637  
mitotic checkpoint serine/threonine-protein kinase BUB1 beta [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Cell cycle
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    12236 (Bub1b)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    12236 (Bub1b)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     12236 (Bub1b)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: Other group
  BUB family
   12236 (Bub1b)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     12236 (Bub1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2; 2 E5
AA seq 1052 aa AA seqDB search
MAEASEAMCLEGAEWELSKENIQPLRHGRVMSTLQGALAKQESAGHTALQQQKRAFESEI
RFYSGDDPLDVWDRYINWTEQNYPQGGKESNMSALVERAIEALQGETRYYNDPRFLSLWI
KLGHLCNEPLDMYSYLQSQGIGVSLAQFYISWAEEYEARENFKKADIIFQEGIERKAEPL
DRLQSQHRQFQSRVSRQAFLALGNEEEEALEPSEPQRSSLAELKSRGKKMARAPISRVGG
ALKAPGQSRGFLNAVPQPVHGNRRITVFDENADTASRTELSKPVAQPWMAPPVPRAKENE
LQPGPWSTDRPAGRRPHDNPASVTSIPSVLPSFTPYVEESAQQTVMTPCKIEPSINHVLS
TRKPGREEGDPLQRVQSHQQGCEEKKEKMMYCKEKIYAGVGEFSFEEIRAEVFRKKLKER
REAELLTSAKKREEMQKQIEEMERRLKAMQAVQQEGAGGQQEEKMPTEDPARLQIASGPQ
EMSGVPLSCSICPLSSNPREISPAENILQEQPDSKGSSMPFSIFDESLSDKKDKSPATGG
PQVLNAQRRPLSVLKTTEVGTTNEDVSPDICDELTELEPLSEDAIITGFRNVTLCPNPED
TCDFARAARLASTPFHEILSSKGIAADPEGLLQEEDLDGKAAEAHHTVHHQALIIKKLSP
IIEESREATHSSGFSRSSSSAPSTSSIKGFQLLEKLELTNDGAEDAIQSPWCSQYRLQLL
KSLLELSAFAEFSVEDRPMPVLEIGKEIELGPEDYVIKQEHLTCDDYRLFWVAPRSSAEL
TMIKASSQPIPWDFYINLKLKERLNEDYDQLCSCCQYQDGHVVWYQYINCSTLQNLLQHS
EFVTHEIIVLIIYNLLTIVEKLHRAEIVHGDLSPRSLILRNRIHDPYDYVNKDDHAVRIM
DFSYSVDLRVQLDAFAYSGFRTAQILEGQKILANCSSPYHVDLLGIADLAHLLLFKEHLH
VFWDGLLWKLSQSTSELKDSELWNKFFVRILNASDKSTVSVLGELAAEMGGAFDATFHSH
LNRALWKLGKTISPEALLTQQDKQPGGSQSPA
NT seq 3159 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggcgagtgaagccatgtgcctggagggagcagagtgggagctgagtaaagaa
aacatacagcccttacggcacgggcgggtcatgtccacacttcagggagctttggcaaag
caagagtcagccggccacactgctctgcagcagcagaaacgggcatttgaatctgaaatc
cgcttttactctggagatgaccctctggatgtgtgggacagatatattaattggacagaa
cagaactaccctcaaggggggaaagagagtaacatgtcagcgttagtggagagagcgata
gaagcactccaaggagagacgcgctattataatgacccccgctttctcagtctctggatc
aaattgggacatttgtgcaatgaacctttggatatgtacagctatttacaaagccaagga
attggcgtttcccttgcccagttctatatttcatgggctgaagaatacgaagctagagaa
aatttcaagaaagcggacataatattccaggaagggattgaacgcaaggctgagcccctg
gacagactgcagtcccagcacagacagttccagtctcgagtgtcgcgacaagctttcttg
gcccttgggaatgaagaggaggaggctttggagccttctgaaccacagagaagctcgcta
gctgagctgaagagcagagggaagaagatggccagagcgcccatcagccgtgtcggaggt
gctctgaaagctccaggtcagagcagagggttcctaaatgcagttccccagccagtacac
ggtaatcgcaggatcaccgtttttgatgaaaatgccgataccgcgtctagaacggagtta
tctaagcctgtagcccagccatggatggcaccccctgtgcccagggccaaagagaacgaa
cttcagccaggcccatggagcacagacaggccggcgggacgcaggcctcatgacaatcca
gcctctgtgacgtcgattcccagcgtgcttcccagctttacgccgtacgtggaagagagc
gcccagcagacagtcatgacaccatgcaagattgagcctagtatcaaccatgttctcagc
accaggaagccagggagagaagaaggagaccccttgcagagagttcagagtcatcagcaa
ggctgtgaggagaagaaggagaagatgatgtactgtaaggagaagatctatgccggagtt
ggggagttctcctttgaggagatccgagctgaagtgttccgaaagaagctgaaagaacga
agggaagccgagctgttgaccagtgcaaagaagagggaggagatgcagaagcagatcgaa
gagatggagaggaggctgaaggcaatgcaggctgttcagcaagaaggagctgggggccag
caagaagagaagatgcctacagaggacccagccagattgcagattgcttcggggcctcag
gaaatgtcgggagttcctctgtcctgttccatctgtccactaagctcgaatcctagggaa
atttcacctgctgagaacattttgcaagaacagcctgattctaaaggttccagtatgcct
ttctccatttttgatgagtctctttcagacaaaaaggacaaaagtcctgctacaggtggt
ccacaggttctcaatgcccagagaagacccctttcagttctcaaaactacagaagtgggc
accacaaatgaggatgtgtctcccgatatttgtgatgaactcacagaacttgagcctctg
agtgaagacgccatcatcactggtttcaggaacgtcactctctgtcccaaccctgaggac
acttgtgactttgctagagcagctcgtttggcatctactcctttccatgagatactgtcc
tcgaagggcatcgctgctgatcccgagggactgttgcaggaagaggatctggatgggaag
gccgccgaggctcatcacactgttcatcaccaggccctcatcataaagaaactgagccca
attattgaagagagccgtgaggccacccactcatctggcttctccaggtcttcttcctca
gctcccagtacatcctccatcaaaggctttcagcttctggaaaagctggagctgactaat
gacggggcagaagatgctattcagtcaccctggtgttcacagtatcgcctacaactgtta
aaatccctactagaattaagtgcttttgcggagttttctgtggaagaccgaccgatgcct
gtgctggaaatagggaaggagattgagttaggtcctgaggattacgtcatcaagcaagag
cacctaacatgtgacgattacaggttattctgggtggcaccaagaagctctgcagagcta
accatgataaaggcatcatctcagcctatcccgtgggatttttatatcaacctcaagttg
aaggagcgtctgaatgaggactatgaccagctttgcagctgctgtcagtaccaagatggc
catgttgtttggtaccagtatataaactgctccacccttcagaatcttctccaacacagc
gaatttgttactcatgaaataatagtgttgattatttacaacctcttgacaatcgtggag
aagctacacagagctgaaatagtacacggagacttgagtccacggagtctgatcctacga
aacagaatccacgacccctatgactatgtaaataaggacgatcacgctgtgaggatcatg
gacttctcctacagtgttgacctgagggtgcagctggatgcgtttgcctatagtggcttt
cggactgcacagatcctggaaggacaaaagatcctggctaactgttcttctccctaccat
gtagatctgttgggtatagcagacctagcgcacttactcctgttcaaggagcacctccat
gtcttctgggatggactcctctggaaacttagccagagcacctctgagctaaaagacagt
gaattgtggaataaattctttgtgcggattctgaatgccagtgacaagtccacagtgtct
gttctgggggagctggcagcagaaatgggtggggcttttgatgccacattccatagccac
ctgaacagagccctgtggaagctggggaagacaatcagcccggaagctttgctcactcag
caagacaagcagccaggcggctcccagagccctgcctaa

DBGET integrated database retrieval system