KEGG   Mus musculus (mouse): 12262Help
Entry
12262             CDS       T01002                                 

Gene name
C1qc, AI385742, C1qg, Ciqc
Definition
complement component 1, q subcomponent, C chain
Orthology
K03988  
complement C1q subcomponent subunit C
Organism
mmu  Mus musculus (mouse)
Pathway
Complement and coagulation cascades
Prion diseases
Pertussis
Chagas disease (American trypanosomiasis)
Staphylococcus aureus infection
Systemic lupus erythematosus
Class
Organismal Systems; Immune system; Complement and coagulation cascades [PATH:mmu04610]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:mmu05322]
Human Diseases; Neurodegenerative diseases; Prion diseases [PATH:mmu05020]
Human Diseases; Infectious diseases; Pertussis [PATH:mmu05133]
Human Diseases; Infectious diseases; Staphylococcus aureus infection [PATH:mmu05150]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:mmu05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 D3; 4 69.05 cM
AA seq 246 aa AA seqDB search
MVVGPSCQPPCGLCLLLLFLLALPLRSQASAGCYGIPGMPGMPGAPGKDGHDGLQGPKGE
PGIPAVPGTRGPKGQKGEPGMPGHRGKNGPRGTSGLPGDPGPRGPPGEPGVEGRYKQKHQ
SVFTVTRQTTQYPEANALVRFNSVVTNPQGHYNPSTGKFTCEVPGLYYFVYYTSHTANLC
VHLNLNLARVASFCDHMFNSKQVSSGGVLLRLQRGDEVWLSVNDYNGMVGIEGSNSVFSG
FLLFPD
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggtcgttggacccagttgccagcctccatgtggactttgcctgctgctgctgtttctt
ctggccctaccactcaggagccaggccagcgctggctgctatgggatcccagggatgcca
ggcatgccgggggcccctgggaaggacgggcatgatggactccaggggcccaagggagag
ccaggaatcccagccgtccctgggacccgaggacccaagggtcagaagggcgagcctggc
atgcctggccaccgtgggaaaaatggccccagggggacctcagggttgccaggggaccca
ggccccagggggcctccgggggagccaggtgtggagggccgatacaaacagaagcaccag
tcggtattcacagtcacccggcagaccacccagtacccagaggccaacgccctcgtcagg
ttcaactctgtggtcaccaaccctcaggggcattacaacccaagcacagggaagttcacc
tgtgaagtgccgggcctctactacttcgtctactacacatcgcatacggccaacctgtgc
gtgcacctgaacctcaaccttgccagggtggccagcttctgcgaccacatgttcaacagc
aagcaggtcagctccggaggagtcctcctgcggctccagaggggcgatgaggtgtggcta
tcagtcaatgactacaatggcatggtgggcatagagggctccaacagcgtcttctctggt
ttcctactgtttcccgactag

DBGET integrated database retrieval system