KEGG   Mus musculus (mouse): 12262Help
Entry
12262             CDS       T01002                                 

Gene name
C1qc, AI385742, C1qg, Ciqc
Definition
complement component 1, q subcomponent, C chain
Orthology
K03988  
complement C1q subcomponent subunit C
Organism
mmu  Mus musculus (mouse)
Pathway
Complement and coagulation cascades
Prion diseases
Pertussis
Chagas disease (American trypanosomiasis)
Staphylococcus aureus infection
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    12262 (C1qc)
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    12262 (C1qc)
  Neurodegenerative diseases
   05020 Prion diseases
    12262 (C1qc)
  Infectious diseases
   05133 Pertussis
    12262 (C1qc)
   05150 Staphylococcus aureus infection
    12262 (C1qc)
   05142 Chagas disease (American trypanosomiasis)
    12262 (C1qc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 D3; 4 69.05 cM
AA seq 246 aa AA seqDB search
MVVGPSCQPPCGLCLLLLFLLALPLRSQASAGCYGIPGMPGMPGAPGKDGHDGLQGPKGE
PGIPAVPGTRGPKGQKGEPGMPGHRGKNGPRGTSGLPGDPGPRGPPGEPGVEGRYKQKHQ
SVFTVTRQTTQYPEANALVRFNSVVTNPQGHYNPSTGKFTCEVPGLYYFVYYTSHTANLC
VHLNLNLARVASFCDHMFNSKQVSSGGVLLRLQRGDEVWLSVNDYNGMVGIEGSNSVFSG
FLLFPD
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggtcgttggacccagttgccagcctccatgtggactttgcctgctgctgctgtttctt
ctggccctaccactcaggagccaggccagcgctggctgctatgggatcccagggatgcca
ggcatgccgggggcccctgggaaggacgggcatgatggactccaggggcccaagggagag
ccaggaatcccagccgtccctgggacccgaggacccaagggtcagaagggcgagcctggc
atgcctggccaccgtgggaaaaatggccccagggggacctcagggttgccaggggaccca
ggccccagggggcctccgggggagccaggtgtggagggccgatacaaacagaagcaccag
tcggtattcacagtcacccggcagaccacccagtacccagaggccaacgccctcgtcagg
ttcaactctgtggtcaccaaccctcaggggcattacaacccaagcacagggaagttcacc
tgtgaagtgccgggcctctactacttcgtctactacacatcgcatacggccaacctgtgc
gtgcacctgaacctcaaccttgccagggtggccagcttctgcgaccacatgttcaacagc
aagcaggtcagctccggaggagtcctcctgcggctccagaggggcgatgaggtgtggcta
tcagtcaatgactacaatggcatggtgggcatagagggctccaacagcgtcttctctggt
ttcctactgtttcccgactag

DBGET integrated database retrieval system