KEGG   Mus musculus (mouse): 12267Help
Entry
12267             CDS       T01002                                 

Gene name
C3ar1, AZ3B, C3AR, HNFAG09
Definition
(RefSeq) complement component 3a receptor 1
  KO
K04009  
C3a anaphylatoxin chemotactic receptor
Organism
mmu  Mus musculus (mouse)
Pathway
Neuroactive ligand-receptor interaction
Complement and coagulation cascades
Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    12267 (C3ar1)
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    12267 (C3ar1)
 Human Diseases
  Infectious diseases
   05150 Staphylococcus aureus infection
    12267 (C3ar1)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Complement peptide
   Anaphylatoxin
    12267 (C3ar1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6; 6 F1
AA seq 477 aa AA seqDB search
MESFDADTNSTDLHSRPLFQPQDIASMVILGLTCLLGLLGNGLVLWVAGVKMKTTVNTVW
FLHLTLADFLCCLSLPFSLAHLILQGHWPYGLFLCKLIPSIIILNMFASVFLLTAISLDR
CLIVHKPIWCQNHRNVRTAFAICGCVWVVAFVMCVPVFVYRDLFIMDNRSICRYNFDSSR
SYDYWDYVYKLSLPESNSTDNSTAQLTGHMNDRSAPSSVQARDYFWTVTTALQSQPFLTS
PEDSFSLDSANQQPHYGGKPPNVLTAAVPSGFPVEDRKSNTLNADAFLSAHTELFPTASS
GHLYPYDFQGDYVDQFTYDNHVPTPLMAITITRLVVGFLVPFFIMVICYSLIVFRMRKTN
FTKSRNKTFRVAVAVVTVFFICWTPYHLVGVLLLITDPESSLGEAVMSWDHMSIALASAN
SCFNPFLYALLGKDFRKKARQSIKGILEAAFSEELTHSTNCTQDKASSKRNNMSTDV
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggagtctttcgatgctgacaccaattcaactgacctacactcacggcctctgtttcaa
ccccaagacattgcctccatggtcattcttggtctcacttgtctattgggactgctaggc
aatgggctggtgctgtgggtagctggcgtaaagatgaagacgaccgtgaacacagtctgg
ttcctccatctcaccctggccgatttcctctgctgcctctccttgcccttctccttggct
cacctgattctccaaggacactggccctatggcttgttcctgtgcaaacttatcccatcc
atcattattctcaacatgtttgccagtgtcttcctgcttactgccattagcctggaccga
tgtctgatagtacataagccaatctggtgccagaatcatcgaaacgtgagaaccgccttc
gccatctgtggatgtgtctgggtggtagcctttgtgatgtgtgtgcccgtatttgtatac
cgtgatctgttcattatggacaatcgcagtatatgtagatataattttgattcctccagg
tcatatgattattgggactacgtgtacaaactaagtctaccagaaagcaattctactgat
aactccactgctcagctaactggacatatgaatgacaggtcagctccttcctctgtacag
gcaagggattacttttggacagttaccactgccctccagtcacagccattcctaacatct
cctgaagactcattctctctagattcagcaaaccaacaaccccattatggtggaaagcct
cctaatgtcctcacagccgccgtacccagcgggtttcctgttgaagatcgtaaatccaat
acactgaacgctgacgcttttctctctgctcacacagaacttttccctactgcttctagt
ggtcatttatacccctatgatttccagggggattatgttgaccaattcacgtatgacaat
catgtgccgacaccgctgatggcaataaccatcacaaggctggtggtgggcttcctggtg
ccgtttttcatcatggtaatttgttacagcctcatcgtcttcagaatgcgaaaaaccaac
ttcaccaagtctcggaacaaaacctttcgggtggctgtggctgtggtcactgtctttttt
atctgctggactccataccatcttgtcggagtcctgctattgattactgatccagaaagt
tccttgggggaagctgtgatgtcctgggaccacatgtccattgctttagcatctgccaat
agttgcttcaaccctttcctgtatgccctcttggggaaagactttaggaagaaagcaaga
cagtctataaagggcattctggaagcagccttcagcgaagagctcacgcactctaccaac
tgtacccaagacaaagcctcttcaaaaagaaacaatatgagtacagatgtgtga

DBGET integrated database retrieval system