KEGG   Mus musculus (mouse): 12273Help
Entry
12273             CDS       T01002                                 

Gene name
C5ar1, C5aR, C5r1, Cd88, D7Msu1
Definition
(RefSeq) complement component 5a receptor 1
  KO
K04010  
C5a anaphylatoxin chemotactic receptor
Organism
mmu  Mus musculus (mouse)
Pathway
Neuroactive ligand-receptor interaction
Complement and coagulation cascades
Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    12273 (C5ar1)
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    12273 (C5ar1)
 Human Diseases
  Infectious diseases
   05150 Staphylococcus aureus infection
    12273 (C5ar1)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Complement peptide
   Anaphylatoxin
    12273 (C5ar1)
Cellular antigens [BR:mmu04090]
 Proteins
  12273 (C5ar1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
7 A2; 7 8.77 cM
AA seq 351 aa AA seqDB search
MDPIDNSSFEINYDHYGTMDPNIPADGIHLPKRQPGDVAALIIYSVVFLVGVPGNALVVW
VTAFEARRAVNAIWFLNLAVADLLSCLALPVLFTTVLNHNYWYFDATACIVLPSLILLNM
YASILLLATISADRFLLVFKPIWCQKVRGTGLAWMACGVAWVLALLLTIPSFVYREAYKD
FYSEHTVCGINYGGGSFPKEKAVAILRLMVGFVLPLLTLNICYTFLLLRTWSRKATRSTK
TLKVVMAVVICFFIFWLPYQVTGVMIAWLPPSSPTLKRVEKLNSLCVSLAYINCCVNPII
YVMAGQGFHGRLLRSLPSIIRNALSEDSVGRDSKTFTPSTTDTSTRKSQAV
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggaccccatagataacagcagctttgaaatcaactatgatcactatggaaccatggat
cctaacatacctgcggatggcattcacctcccgaagcggcaacctggggatgttgcagcc
cttatcatctactcggtggtgttcctggtgggagtacctgggaatgccctggtggtgtgg
gtgacagccttcgaggccagacgggccgtcaacgccatctggtttctgaatctggcggtg
gccgacctcctctcgtgcttggcactgcctgtcctgttcacgaccgttttaaatcataac
tactggtactttgatgccaccgcctgtatagtcctgccctcgctcatcctgctcaacatg
tacgccagtatcctgctgctggctaccattagtgccgaccgtttcctgctggtgttcaag
cccatctggtgtcagaaggtccgcgggactggcctggcatggatggcctgtggagtggcc
tgggtcttagcattgctcctcaccattccatccttcgtgtaccgggaggcatataaggac
ttctactcagagcacactgtatgtggtattaactatggtgggggtagcttccccaaagag
aaggctgtggccatcctgcggctgatggtgggttttgtgttgcctctgctcactctaaac
atctgctacaccttcctcctgctccggacctggagtcgcaaggccacgcgctccaccaag
acgctcaaagtggtgatggctgtggtcatctgtttctttatcttctggctgccctatcag
gtgaccggggtgatgatagcgtggctgcccccgtcctcgcccaccttgaagagggtggag
aagctgaactccctgtgcgtgtccctggcctacatcaactgctgtgttaaccctatcatc
tacgtcatggctggccagggtttccatggacgactcctaaggtctctccccagcatcata
cgaaacgctctctctgaggattcagtgggcagggatagcaagactttcactccgtccacg
acggacacctcaacccggaagagtcaggcggtgtag

DBGET integrated database retrieval system