KEGG   Mus musculus (mouse): 12282Help
Entry
12282             CDS       T01002                                 

Gene name
Hyou1, AI415631, CBP-140, Cab140, Grp170, Orp150
Definition
(RefSeq) hypoxia up-regulated 1
  KO
K09486  
hypoxia up-regulated 1
Organism
mmu  Mus musculus (mouse)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    12282 (Hyou1)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP110
   12282 (Hyou1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
9; 9 B
AA seq 999 aa AA seqDB search
MAATVRRQRPRRLLCWALVAVLLADLLALSDTLAVMSVDLGSESMKVAIVKPGVPMEIVL
NKESRRKTPVTVTLKENERFLGDSAAGMAIKNPKATLRYFQHLLGKQADNPHVALYRSRF
PEHELIVDPQRQTVRFQISPQLQFSPEEVLGMVLNYSRSLAEDFAEQPIKDAVITVPAFF
NQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDINSTAQNVMFYDMGSGSTVC
TIVTYQTVKTKEAGMQPQLQIRGVGFDRTLGGLEMELRLREHLAKLFNEQRKGQKAKDVR
ENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVTRVEFEELCADLFDRVP
GPVQQALQSAEMSLDQIEQVILVGGATRVPKVQEVLLKAVGKEELGKNINADEAAAMGAV
YQAAALSKAFKVKPFVVRDAVIYPILVEFTREVEEEPGLRSLKHNKRVLFSRMGPYPQRK
VITFNRYSHDFNFHINYGDLGFLGPEDLRVFGSQNLTTVKLKGVGESFKKYPDYESKGIK
AHFNLDESGVLSLDRVESVFETLVEDSPEEESTLTKLGNTISSLFGGGTSSDAKENGTDA
VQEEEESPAEGSKDEPAEQGELKEEAEPPAEETSQPPPSEPKGDAAREGEKPDEKESGDK
PEAQKPNEKGQAGPEGAAPAPEEDKKPKPARKQKMVEEIGVELAVLDLPDLPEDELARSV
QKLEELTLRDLEKQEREKAANSLEAFIFETQDKLYQPEYQEVSTEEQREEISGKLSATST
WLEDEGFGATTVMLKDKLAELRKLCQGLFFRVEERRKWPERLSALDNLLNHSSIFLKGAR
LIPEMDQVFTEVEMTTLEKVINDTWAWKNATLAEQAKLPATEKPVLLSKDIEAKMMALDR
EVQYLLNKAKFTKPRPRPKDKNGTRAEPPLNASAGDQEEKVIPPAGQTEEAKPILEPDKE
ETGTEPADSEPLELGGPGAGPEQEEQSAGQKRPSKNDEL
NT seq 3000 nt NT seq  +upstreamnt  +downstreamnt
atggcagccacagtaagaaggcagaggccaaggaggctactctgttgggccttggtggct
gtcctcttggcagacctgttggcactgagcgacacattggctgtgatgtctgtagacctg
ggcagtgaatccatgaaggtggccattgtcaagcctggagtgcccatggagattgtattg
aacaaggaatctcggaggaaaactccagtgactgtgaccttgaaagaaaatgaaaggttt
ttaggtgatagtgcagccggcatggccatcaagaacccaaaggctacgctccgttatttc
cagcacctccttggaaaacaggcggataaccctcatgtggccctttaccggtcccgtttc
ccagaacatgagctaattgttgacccacagaggcagactgtgcgcttccagatcagtccg
cagctgcagttctctcccgaggaggtactgggcatggttctgaactactcccgttccttg
gctgaagattttgctgaacaacccattaaggatgcagtgatcaccgtgccagcctttttc
aaccaggctgagcgccgagctgtgctgcaggctgctcggatggctggcctcaaggtgctg
cagctcatcaatgacaacactgccacagccctcagctacggtgtcttccgccggaaagat
atcaattccactgcacagaacgtcatgttctatgacatgggctcgggcagcactgtgtgc
accatcgtcacctaccagacagtgaagactaaggaggctgggatgcaaccacagctgcag
atccggggcgtgggatttgaccgcaccctgggtggcctggagatggagcttcggcttcga
gaacacctggctaagctcttcaatgagcagcgcaagggccagaaagccaaggatgttcgg
gaaaacccccgggccatggccaaactgcttcgggaagccaaccggcttaaaaccgtcctg
agtgccaacgctgatcacatggcacagattgagggcttgatggatgatgtggacttcaag
gccaaagtaactcgggtggaattcgaggagctgtgtgcagatttgtttgaccgtgtgcct
ggacctgtgcagcaggccttgcagagtgcagagatgagcttggatcaaattgagcaggtg
atcctggtgggcggggccactcgtgttcccaaagttcaagaagtgctgctcaaggccgtg
ggcaaggaggaactaggaaagaacatcaatgcggacgaagctgctgccatgggggctgtg
taccaggcagcggcgctcagcaaggccttcaaagtgaagccatttgttgtgcgggatgct
gtcatttacccaatcctggtggagttcacaagggaggtggaggaggagcctgggctccga
agcctgaaacacaataagcgtgtgctcttctcccgaatggggccctaccctcagcgcaaa
gtcatcacctttaaccgctacagccatgatttcaacttccacatcaactacggtgacctg
ggcttcctggggcctgaggatcttcgggtatttggctcccagaatctgaccacagtaaaa
ctaaaaggcgtgggagagagcttcaagaaatatcccgactatgagtccaaaggcatcaag
gcccactttaacctggatgagagtggcgtgctcagtttagacagggtggagtccgtattt
gagaccctggtggaggatagcccagaggaagaatctactcttaccaaacttggcaacacc
atatccagcctgtttggaggtggtacctcatcagatgccaaagagaatggtactgatgct
gtacaggaggaagaggagagccccgctgaggggagcaaggatgagcctgcagagcagggg
gaactcaaggaagaagctgaacccccagcagaggagacctctcagcctccaccctctgag
cctaagggggatgcagcccgtgagggagagaaacctgatgaaaaagagagtggggacaag
cctgaggcccagaagcccaatgagaaggggcaagcagggcctgagggtgctgctccagct
cctgaggaggacaaaaagccgaaacctgcccggaagcagaaaatggtggaggagataggt
gtggagctggctgtcttggacctgcctgacttgccagaggatgagctggcccgttctgtg
cagaaacttgaagaactgaccctgcgcgacctagagaagcaggagagggagaaagctgcc
aacagcttggaggctttcatctttgagacccaggacaagctgtaccagcctgagtaccag
gaagtgtccactgaggaacagcgggaggagatctcggggaaactcagcgccacttctacc
tggctggaggatgagggatttggagccaccactgtgatgctgaaggacaagctggctgag
ctgagaaagctgtgccaagggctgttttttcgggtggaagaacgcaggaaatggccagag
cggctttcagctctggataatctcctcaaccattccagcattttcctcaagggtgcccgg
ctcatcccggagatggaccaggtcttcactgaagtggagatgacgacattagagaaagtc
atcaatgacacctgggcctggaagaatgcaactctggccgaacaagccaagcttcctgcc
acagagaagcctgtgctgctttcaaaagacattgaggccaaaatgatggccctggaccgg
gaggtacagtatctactcaataaggccaagtttaccaagccacggccacggcccaaagac
aagaatggcacccgggcagaacctcccctcaatgccagtgctggtgaccaagaggagaag
gtcattccacctgcaggccagactgaagaggcgaaacccattttagaacctgacaaagaa
gagactggtacggaaccagcagactcggagcctctggaattaggaggtcctggagctgga
cctgaacaggaagagcagtcagcaggacagaagcggccttcaaagaacgatgaactataa

DBGET integrated database retrieval system