KEGG   Mus musculus (mouse): 12287Help
Entry
12287             CDS       T01002                                 

Gene name
Cacna1b, AW050276, AW060892, AW822256, Cav2.2, Cchn1a, alpha(1B)
Definition
(RefSeq) calcium channel, voltage-dependent, N type, alpha 1B subunit
  KO
K04849  
voltage-dependent calcium channel N type alpha-1B
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Synaptic vesicle cycle
Retrograde endocannabinoid signaling
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Type II diabetes mellitus
Morphine addiction
Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    12287 (Cacna1b)
   04020 Calcium signaling pathway
    12287 (Cacna1b)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    12287 (Cacna1b)
   04725 Cholinergic synapse
    12287 (Cacna1b)
   04728 Dopaminergic synapse
    12287 (Cacna1b)
   04726 Serotonergic synapse
    12287 (Cacna1b)
   04723 Retrograde endocannabinoid signaling
    12287 (Cacna1b)
   04721 Synaptic vesicle cycle
    12287 (Cacna1b)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    12287 (Cacna1b)
   05033 Nicotine addiction
    12287 (Cacna1b)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    12287 (Cacna1b)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN alpha-1, CaVx.x
   12287 (Cacna1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 16.58 cM; 2 A2
AA seq 2327 aa AA seqDB search
MVRFGDELGGRYGGTGGGERARGGGAGGAGGPGQGGLPPGQRVLYKQSIAQRARTMALYN
PIPVKQNCFTVNRSLFVFSEDNVVRKYAKRITEWPPFEYMILATIIANCIVLALEQHLPD
GDKTPMSERLDDTEPYFIGIFCFEAGIKIIALGFVFHKGSYLRNGWNVMDFVVVLTGILA
TAGTDFDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMVPLLQIGLLLFFAILMFAII
GLEFYMGKFHKACFPNSTDTEPVGDFPCGKDPPARQCDGDTECREYWPGPNFGITNFDNI
LFAILTVFQCITMEGWTDILYNTNDAAGNTWNWLYFIPLIIIGSFFMLNLVLGVLSGEFA
KERERVENRRAFLKLRRQQQIERELNGYLEWIFKAEEVMLAEEDKNAEEKSPLDVLKRAA
TKKSRNDLIHAEEGEDRFVDLCAVGSPFARASLKSGKTESSSYFRRKEKMFRFFIRRMVK
AQSFYWVVLCVVALNTLCVAMVHYNQPQRLTTALYFAEFVFLGLFLTEMSLKMYGLGPRS
YFRSSFNCFDFGVIVGSIFEVVWAAIKPGTSFGISVLRALRLLRIFKVTKYWNSLRNLVV
SLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFQDETPTTNFDTFPAAILTVFQIL
TGEDWNAVMYHGIESQGGVSKGMFSSFYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTK
DEEEMEEAANQKLALQKAKEVAEVSPMSAANISIAARQQNSAKARSVWEQRASQLRLQNL
RASCEALYSEMDPEERLRYASTRHVRPDMKTHMDRPLVVEPGRDGLRGPVGSKSKPEGTE
ATESADLPRRHHRHRDRDKTSATAPAGGEQDRTESTETGAREERARPRRSHSKETPGADT
QVRCERSRRHHRRGSPEEATEREPRRHRAHRHAQDSSKEGTAPVLVPKGERRARHRGPRT
GPREAENNEEPTRRHRARHKVPPTLQPPEREAAEKESNAVEGDKETRNHQPKEPHCDLEA
IAVTGVGPLHMLPSTCLQKVDEQPEDADNQRNVTRMGSQPSDPSTTVHVPVTLTGPPGET
PVVPSGNMNLEGQAEGKKEAEADDVLRRGPRPIVPYSSMFCLSPTNLLRRFCHYIVTMRY
FEMVILVVIALSSIALAAEDPVRTDSFRNNALKYMDYIFTGVFTFEMVIKMIDLGLLLHP
GAYFRDLWNILDFIVVSGALVAFAFSSFMGGSKGKDINTIKSLRVLRVLRPLKTIKRLPK
LKAVFDCVVNSLKNVLNILIVYMLFMFIFAVIAVQLFKGKFFYCTDESKELERDCRGQYL
DYEKEEVEAQPRQWKKYDFHYDNVLWALLTLFTVSTGEGWPMVLKHSVDATYEEQGPSPG
FRMELSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKVMSECSLEKNERACIDFAISAK
PLTRYMPQNKQSFQYKTWTFVVSPPFEYFIMAMIALNTVVLMMKFYDAPYEYELMLKCLN
IVFTSMFSMECILKIIAFGVLNYFRDAWNVFDFVTVLGSITDILVTEIANNFINLSFLRL
FRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIALDDD
TSINRHNNFRTFLQALMLLFRSATGEAWHEIMLSCLGNRACDPHANASECGSDFAYFYFV
SFIFLCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFIRVWAEYDPAACGRISYNDM
FEMLKHMSPPLGLGKKCPARVAYKRLVRMNMPISNEDMTVHFTSTLMALIRTALEIKLAP
AGTKQHQCDAELRKEISSVWANLPQKTLDLLVPPHKPDEMTVGKVYAALMIFDFYKQNKT
TRDQTHQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSATSLSNGGAIQTQ
ESGIKESLSWGTQRTQDALYEARAPLERGHSAEIPVGQSGTLAVDVQMQNMTLRGPDGEP
QPGLESQGRAASMPRLAAETQPAPNASPMKRSISTLAPRPHGTQLCSTVLDRPPPSQASH
HHHHRCHRRRDKKQRSLEKGPSLSVDPEGAPSTAAGPGLPHGEGSTACRRDRKQERGRSQ
ERRQPSSSSSEKQRFYSCDRFGSREPPQLMPSLSSHPTSPTAALEPAPHPQGSGSVNGSP
LMSTSGASTPGRGGRRQLPQTPLTPRPSITYKTANSSPVHFAEGQSGLPAFSPGRLSRGL
SEHNALLQKEPLSQPLAPGSRIGSDPYLGQRLDSEASAHTLPEDTLTFEEAVATNSGRSS
RTSYVSSLTSQSHPLRRVPNGYHCTLGLSTGVRARHSYHHPDQDHWC
NT seq 6984 nt NT seq  +upstreamnt  +downstreamnt
atggtccgcttcggggacgagctaggcggccgctatgggggcaccggcggcggggagcgg
gctcggggtggcggggccggcggggcgggtggcccgggccaggggggtctgccgccgggc
cagcgggtcctgtacaagcagtccattgcgcagcgcgcacggactatggccctgtacaac
cccatcccagtcaagcagaactgcttcaccgtcaaccgctcgctcttcgtcttcagcgag
gacaacgtcgtccgcaaatacgctaagcgcatcaccgaatggccgcccttcgaatacatg
atcctggccaccatcatcgccaactgcattgttctggccctggagcagcacctccctgat
ggggacaagactcccatgtctgagcgactagatgacacggagccttacttcatcgggatc
ttttgcttcgaggcgggcatcaagatcatagccctgggctttgttttccacaagggctcc
taccttcggaacggctggaatgtcatggacttcgtggtggtcctcacggggattctcgcc
acagctggaactgactttgacctgcgcacactgagggctgtgcgtgtgcttaggcccctg
aagctggtgtctggaattccaagcttgcaggtggtgcttaagtccatcatgaaggccatg
gtcccgctgctgcagattgggctgctgctcttctttgccatcctcatgtttgccatcatc
ggcctcgaattctatatgggcaaattccataaggcctgtttccccaacagcacagataca
gagcctgtgggtgactttccctgtggcaaagatccccctgctcgtcagtgtgatggtgac
accgaatgccgggagtactggccaggacccaactttggcatcaccaattttgacaacatc
ctgtttgccatcttgacagtgttccagtgtatcaccatggagggctggactgacatcctc
tacaatacaaatgatgcggctggcaacacatggaactggttgtacttcatccccctcatc
atcattggctccttcttcatgctcaacctggtgctgggtgtgctttccggagagtttgcc
aaggagcgggagcgagtcgagaaccgccgcgccttcctgaagctccgcaggcagcagcag
attgagcgagagctgaatgggtacttggagtggatcttcaaggcagaggaagtcatgttg
gcagaggaggacaagaatgcagaagagaaatcccctttggatgtgttgaagagagctgcc
accaagaagagccgaaatgacctcatccatgcagaagagggggaggaccggtttgtagac
ctctgtgcagttgggtctccatttgctcgtgccagcctcaagagtgggaagacggagagc
tcatcgtacttccggagaaaggagaagatgttccggttctttatccggcgtatggtgaaa
gcacagagcttctactgggtggtactgtgtgtggtggccctgaacacactgtgtgtggcc
atggtgcactataatcagcctcagcggcttaccactgcactgtactttgcagagtttgtt
ttcctgggtctcttcctcacagagatgtccctgaagatgtatggcctagggcccagaagt
tacttcaggtcttccttcaactgctttgactttggggtgattgtggggagtatctttgaa
gtagtctgggctgccatcaagccaggaacctcctttggaatcagtgtgctgcgggctctg
cgactgctgaggatattcaaagttaccaagtattggaactctctgaggaacctggtggtt
tccctcctcaattccatgaagtccatcatcagccttctcttcctgcttttcctcttcatc
gtggtcttcgctctgttggggatgcagctgtttgggggacagttcaactttcaagatgag
actccaaccaccaattttgataccttcccagctgccatcctcactgtctttcagatcctg
acaggagaggattggaatgccgtaatgtatcatgggattgagtcgcaaggtggagtcagc
aaaggcatgttttcttccttttacttcatcgtcctgacactgtttggaaactacaccctg
ctgaatgtttttctggccattgctgtggacaaccttgccaatgcccaggagttgaccaag
gatgaagaggagatggaagaagcagccaatcagaaacttgctcttcagaaggccaaagaa
gtagctgaagtcagccccatgtctgctgccaatatctccatcgctgccaggcagcagaac
tcggccaaggcgcgctcagtatgggagcagcgggccagtcagctaaggctccagaatctg
cgtgccagctgtgaggcattgtacagtgagatggaccctgaggagcgcctgcgttatgcc
agcacgcgccatgtgaggccagacatgaagacacacatggaccgacccctagtggtggag
cctggtcgagatggcttgcggggacccgttgggagcaagtcaaagcctgaaggcacggag
gccacagaaagcgcggacctacctcgcaggcaccaccggcaccgtgatagggacaagacc
tcagccacagcacctgctggaggcgaacaggacaggacagaaagcaccgagaccggggcc
cgggaggaacgtgcgcgccctcgtcgaagtcacagcaaggagactccaggggctgacacg
caagtgcgctgtgagcgcagtagacgtcaccaccggcgcggctccccggaggaggccact
gaacgggagcctcggcgccaccgtgcccaccggcatgcacaggactcaagcaaggagggc
acggcgccggtgcttgtacccaagggtgagcgacgagcaagacaccgaggcccacgcacg
ggtccacgtgaggcagagaacaacgaggagcccacacgcaggcaccgtgcaaggcataag
gtgccacccacactgcagcccccagagagggaggctgcagagaaggagagcaacgcggtg
gaaggggataaggaaacccgaaatcaccagcccaaggaacctcactgtgacctggaggcc
attgcagttacaggtgtgggccctctgcacatgctgcccagcacctgtctccagaaagtg
gacgagcaaccagaggatgcagacaaccagcgtaatgtcacccggatgggcagtcagccc
tcagatcccagcaccactgtgcatgtcccagtgacactgacaggccctcctggggagacc
cctgtagttcccagtggtaacatgaacctggaaggccaagcagagggcaagaaggaggca
gaggcggatgatgtgctgagaagaggccccaggcccatcgttccctacagctccatgttt
tgtctcagccccaccaacctgcttcgtcgcttctgccattacattgtgaccatgcggtac
tttgagatggtaattcttgtggtcattgccttgagcagcattgccctggctgcagaggat
cctgtgcggacagattcattcaggaacaacgctttaaagtacatggattacatctttaca
ggagtcttcacctttgaaatggtcataaagatgatagacttgggcttgctgctgcaccct
ggtgcctacttccgggacctgtggaacattctggacttcattgttgtcagtggagccctg
gtggcatttgcgttctcgagcttcatgggaggatccaaagggaaagacatcaataccatc
aagtctctgagagtcctgcgtgtcctgaggcccctcaagaccatcaagcggctgcctaag
ctcaaggctgtctttgactgtgtggtgaactccctgaagaacgtcttgaacatcctgatt
gtctacatgctcttcatgttcatatttgccgtcattgccgtccagctcttcaaagggaag
ttcttttactgtactgatgaatccaaggagctggagagggactgccggggtcagtatttg
gattatgagaaggaagaagtagaagcccagccaaggcagtggaagaaatatgacttccac
tatgacaatgttctctgggccttgttgacgctgttcacagtgtccacgggagaggggtgg
cccatggtgctgaaacactctgtggatgccacctatgaggaacaggggcccagtcccggg
ttccggatggagctctccatcttctacgtggtctactttgtggtcttcccttttttcttt
gtcaacatctttgtggccttgatcattatcaccttccaggaacagggagataaggtgatg
tctgaatgcagcttagaaaagaatgagagggcttgcattgattttgccatcagtgccaag
cccctgacacggtacatgcctcaaaacaaacagtcgttccagtataagacatggacattc
gtggtctctccaccctttgagtacttcatcatggctatgatagccctcaacacagtggtg
ctgatgatgaagttctatgatgcaccttatgagtacgagctgatgctgaaatgcctgaac
attgtcttcacatccatgttctcgatggagtgcatactgaagatcatcgcctttggggta
ttgaactacttcagagatgcctggaacgtctttgactttgtcacggttttgggaagtatt
actgatattttagtaacagagatagcgaacaacttcatcaacctaagcttccttcgcctc
ttccgggcggcacggctgatcaagctgcttcgccagggctacaccatccgcatcctattg
tggaccttcgtccagtcctttaaggcgctgccctacgtgtgcctcctcattgccatgctg
ttcttcatctacgccatcatcggcatgcaggtttttggaaacattgcccttgatgatgac
accagtatcaaccgacacaacaacttccggacatttctgcaagccttaatgctattgttc
aggagtgccactggggaggcctggcatgagatcatgctgtcttgtctgggcaaccgggcc
tgtgacccacatgccaacgccagtgagtgcgggagcgactttgcctatttttattttgtc
tccttcatcttcctctgttcctttctgatgttgaacctctttgttgctgtaatcatggac
aattttgagtacctcactcgggactcttccatcctagggcctcaccacttagacgaattc
attcgagtctgggctgaatacgacccagctgcgtgtgggcgcatcagttacaatgacatg
tttgagatgctgaaacacatgtccccacctctggggttggggaagaaatgcccggctcga
gttgcatacaagcgcctggttcgcatgaacatgcccatatccaatgaggacatgacggtg
cactttacgtccacactgatggccctcatccggacagcactggagatcaagcttgcccca
gcggggacgaagcagcaccagtgtgatgctgagctgagaaaagagatctcttctgtgtgg
gctaatctgccccagaagactctggacttactggtaccaccccacaaacctgacgagatg
acagtggggaaggtctatgctgctctcatgatatttgacttctacaaacagaacaaaacc
accagagatcagactcaccaagctcccggaggcctgtcccagatgggtcccgtttccctg
ttccaccctctgaaggccaccctggaacagacacagcccgctgtgcttcgaggagctcgg
gttttccttcggcaaaagagtgcaacttccctcagcaatgggggtgccatacaaacccag
gaaagtggcatcaaggagtcgctgtcctggggcacgcagaggacccaagatgcactttat
gaggccagagcacctctagaacgtggccattctgcagagatccctgtggggcagtcagga
acactggctgtggatgtccagatgcagaacatgacactgagaggaccagatggggagccc
cagcctgggctggaaagccaaggcagagctgcctctatgccacgcctagcggcagaaaca
cagccggcccctaatgccagccccatgaagcgctccatctccacactggctccacgccca
catgggactcagctttgcagcacagttctggaccggcctcctcctagccaggcatcacat
caccaccaccaccgctgccaccggcgcagagacaagaagcaaaggtccctggaaaagggg
cccagcctgtctgttgacccagaaggtgcaccaagcactgctgcaggacctggtctgccc
catggagaaggatccaccgcctgccggcgggaccgtaaacaggagcgaggccggtcccag
gagcggaggcagccctcatcttcctcttcagagaagcagcgcttctattcctgtgaccgc
tttgggagccgggagcccccgcaactgatgccctcactcagtagccaccccacatcgcca
acagcggcgctagagccagcaccccacccacagggcagtggttccgttaatgggagcccc
ttgatgtcaacatccggtgctagcaccccgggccgaggtgggcggaggcagctcccccag
actcctctgaccccacgccccagcatcacctacaagaccgccaattcctcgcctgtccac
tttgctgagggtcagagcggcctcccagccttctcccctggccgtctcagccgcggcctt
tctgaacacaatgccctgctccagaaagagcccctgagccagcctctagctcctggctcc
cgaattggctctgacccttacctagggcagcgtctggacagtgaggcctccgcccacacc
ctgcctgaggatacactcacctttgaagaggcagtggccaccaactctggccgctcctcc
aggacttcctatgtgtcctccctcacttcccaatcccaccctctccgccgtgtacccaat
ggctatcactgcactttgggactcagcactggcgtccgggcgcggcacagctaccaccac
cccgatcaggaccactggtgctag

DBGET integrated database retrieval system