KEGG   Mus musculus (mouse): 12288Help
Entry
12288             CDS       T01002                                 

Gene name
Cacna1c, Cav1.2, Cchl1a1, D930026N18Rik, MBC, MELC-CC
Definition
(RefSeq) calcium channel, voltage-dependent, L type, alpha 1C subunit
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04713  Circadian entrainment
mmu04720  Long-term potentiation
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu04725  Cholinergic synapse
mmu04726  Serotonergic synapse
mmu04727  GABAergic synapse
mmu04728  Dopaminergic synapse
mmu04742  Taste transduction
mmu04911  Insulin secretion
mmu04912  GnRH signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04924  Renin secretion
mmu04925  Aldosterone synthesis and secretion
mmu04927  Cortisol synthesis and secretion
mmu04930  Type II diabetes mellitus
mmu04934  Cushing's syndrome
mmu05010  Alzheimer's disease
mmu05031  Amphetamine addiction
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    12288 (Cacna1c)
   04020 Calcium signaling pathway
    12288 (Cacna1c)
   04024 cAMP signaling pathway
    12288 (Cacna1c)
   04022 cGMP - PKG signaling pathway
    12288 (Cacna1c)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    12288 (Cacna1c)
   04912 GnRH signaling pathway
    12288 (Cacna1c)
   04921 Oxytocin signaling pathway
    12288 (Cacna1c)
   04924 Renin secretion
    12288 (Cacna1c)
   04925 Aldosterone synthesis and secretion
    12288 (Cacna1c)
   04927 Cortisol synthesis and secretion
    12288 (Cacna1c)
  Circulatory system
   04260 Cardiac muscle contraction
    12288 (Cacna1c)
   04261 Adrenergic signaling in cardiomyocytes
    12288 (Cacna1c)
   04270 Vascular smooth muscle contraction
    12288 (Cacna1c)
  Nervous system
   04724 Glutamatergic synapse
    12288 (Cacna1c)
   04727 GABAergic synapse
    12288 (Cacna1c)
   04725 Cholinergic synapse
    12288 (Cacna1c)
   04728 Dopaminergic synapse
    12288 (Cacna1c)
   04726 Serotonergic synapse
    12288 (Cacna1c)
   04720 Long-term potentiation
    12288 (Cacna1c)
   04723 Retrograde endocannabinoid signaling
    12288 (Cacna1c)
  Sensory system
   04742 Taste transduction
    12288 (Cacna1c)
  Environmental adaptation
   04713 Circadian entrainment
    12288 (Cacna1c)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    12288 (Cacna1c)
  Substance dependence
   05031 Amphetamine addiction
    12288 (Cacna1c)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    12288 (Cacna1c)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    12288 (Cacna1c)
   05414 Dilated cardiomyopathy (DCM)
    12288 (Cacna1c)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    12288 (Cacna1c)
   04934 Cushing's syndrome
    12288 (Cacna1c)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN alpha-1, CaVx.x
   12288 (Cacna1c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel Etmic-2 DUF4834
Motif
Other DBs
NCBI-GeneID: 12288
NCBI-ProteinID: NP_001153005
MGI: 103013
Ensembl: ENSMUSG00000051331
Vega: OTTMUSG00000049004
UniProt: Q01815 Q0PCR6
Position
6 F1; 6 55.86 cM
AA seq 2139 aa AA seqDB search
MVNENTRMYVPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAAR
QAKLMGSAGNATISTVSSTQRKRQQYGKPKKQGGTTATRPPRALLCLTLKNPIRRACISI
VEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFR
VLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYN
QEGIIDVPAEEDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGD
FQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEDKPRNMSMPTSETESVNTENVA
GGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLT
IASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGI
LETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFL
FIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYG
GPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLAR
TASPEKKQEVMEKPAVEESKEEKIELKSITADGESPPTTKINMDDLQPSENEDKSPHSNP
DTAGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSPNNRFRLQCHRIVNDT
IFTNLILFFILLSSISLAAEDPVQHTSFRNHILGNADYVFTSIFTLEIILKMTAYGAFLH
KGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQ
CVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDGE
VDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRV
EISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLR
RYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFTG
LFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNPAEHTQCSPSMSAEEN
SRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQ
VFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNS
TEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRI
WAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNA
TLFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYA
TFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELD
KAMKEAVSAASEDDIFRRAGGLFGNHVTYYQSDSRGNFPQTFATQRPLHINKTGNNQADT
ESPSHEKLVDSTFTPSSYSSTGSNANINNANNTALGRFPHPAGYSSTVSTVEGHGPPLSP
AVRVQEAAWKLSSKRCHSRESQGATVNQEIFPDETRSVRMSEEAEYCSEPSLLSTDMFSY
QEDEHRQLTCPEEDKREIQPSPKRSFLRSASLGRRASFHLECLKRQKDQGGDISQKTALP
LHLVHHQALAVAGLSPLLQRSHSPTTFPRPCPTPPVTPGSRGRPLRPIPTLRLEGAESSE
KLNSSFPSIHCSSWSEETTACSGSSSMARRARPVSLTVPSQAGAPGRQFHGSASSLVEAV
LISEGLGQFAQDPKFIEVTTQELADACDMTIEEMENAADNILSGGAQQSPNGTLLPFVNC
RDPGQDRAVAPEDESCAYALGRGRSEEALADSRSYVSNL
NT seq 6420 nt NT seq  +upstreamnt  +downstreamnt
atggtcaatgaaaacacgaggatgtacgttccagaggaaaaccaccaaggttccaactat
gggagcccacgcccagctcatgccaacatgaatgccaatgcagctgcaggacttgctccc
gagcacatccctactccaggggcagcactgtcctggcaggcagccatcgatgccgcccgg
caggccaagctcatgggcagtgctggcaacgcaaccatctctaccgtcagttccacacag
cggaagcggcagcagtatgggaaacccaagaagcaggggggcacaaccgccacacggccg
ccccgggctctgctgtgtctgaccctgaagaaccctatccggagggcgtgcataagcatt
gttgaatggaaaccatttgaaatcattattttactgactatttttgccaattgtgtggcc
ttagcaatctatattccctttccggaagacgactccaacgccaccaactccaacctggaa
cgagtggagtatctcttcctcatcatttttaccgtggaagcatttttaaaagtaattgcc
tacggacttctcttccaccccaacgcttacctccgcaatggttggaatttactggatttt
ataatcgtggttgtagggctttttagtgcaattttagaacaagcaaccaaagctgatggg
gccaatgctctaggagggaaaggagctggattcgacgtgaaggcactgagagcgttccgc
gtgctccgtccactgcggctagtgtccggagtcccaagtctccaggtggtcctgaactcc
atcatcaaggccatggtgcctctgctgcacattgcccttcttgtgctcttcgtcatcatc
atttatgctattatcggcctggagctcttcatgggaaagatgcacaagacctgctacaac
caggagggcataatagatgttccggcagaagaggatccttccccttgtgctttggagaca
ggccatgggcgacagtgtcagaacgggaccgtgtgcaaacccgggtgggatgggcccaag
cacggcatcaccaacttcgacaacttcgccttcgccatgctgacggtgttccagtgtatc
accatggagggctggacagacgtgctgtactggatgcaagacgctatgggctatgagttg
ccctgggtgtattttgtcagtctggtcatctttggatcctttttcgttctaaatctggtt
ctcggtgttttgagcggggagttttccaaagagagggagaaagccaaagcccgaggagat
ttccagaagcttcgagagaagcagcaactagaagaagatctcaaaggctacctggactgg
atcacccaggcagaagacattgaccccgagaatgaggacgagggcatggatgaagacaag
cctcgaaacatgagcatgcccacaagtgagactgagtctgtcaacactgaaaacgtggct
ggaggtgacatcgagggagaaaactgtggagccaggcttgcccatcggatctccaaatcc
aaattcagccgctactggcgcaggtggaatcgattctgcagaagaaaatgccgtgcagca
gttaagtccaacgtcttctactggctcgtgatcttcctggtgttcctcaacaccctcacc
attgcctccgaacattacaaccagcctcactggctcacagaagtgcaagacacagccaat
aaagccctcctggcccttttcactgcagaaatgctcctgaagatgtacagcctgggtctt
caggcctattttgtgtccctcttcaaccgctttgactgtttcattgtgtgtgggggcatc
ctggagaccatcctggtggagacgaagatcatgtctcccctgggcatctctgtgctgaga
tgtgtgcggttgctcaggatcttcaagatcaccaggtactggaattccttgagcaacctt
gtggcatccttgctgaactcagtgcgctccattgcctccctgctgctgctcctcttcctc
ttcatcatcatcttctccctcctggggatgcagctctttggagggaagttcaatttcgat
gagatgcagacccgtaggagcacgttcgataacttcccgcagtctctcctcactgtgttt
cagatcctgaccggggaggactggaattcggtgatgtatgatgggatcatggcttatggc
ggcccctcttttccagggatgttagtctgtatttacttcatcatcctcttcatctgtgga
aattatatcctactgaatgtgttcttggccattgcggtggacaacctggctgatgcggag
agcctgacctcagcccaaaaggaggaggaagaagagaaggagaggaagaagctggccagg
actgccagcccagaaaagaaacaggaggtgatggagaagccagccgtggaggagagcaaa
gaggagaaaattgaactgaaatccattacagccgatggagaatccccacccactaccaag
atcaacatggatgacctccagcccagtgaaaacgaggataagagtccccactccaaccca
gacactgcaggggaagaggatgaagaggagccagagatgcctgtggggccacgcccccgg
cccctgtctgagctgcaccttaaggaaaaggcagttcccatgccggaagccagtgcattt
ttcatcttcagcccaaacaacaggttccgcctgcagtgccaccgtattgtcaatgacacg
atcttcaccaacctcatcctcttcttcattctgctcagcagcatctctctggctgctgag
gaccccgtccagcacacctccttcaggaaccatatcctaggcaatgcagactatgtcttc
actagtatctttacattagaaattatccttaagatgactgcttacggggctttcctgcac
aagggctctttctgccgaaactacttcaatatcctggacctgctggtggttagcgtgtcc
ctcatctcctttggcatccagtccagcgcgatcaacgttgtgaagattttacgagtgctg
cgagtcctcagacccctgagggccatcaacagggccaaggggctaaagcatgtggttcag
tgcgtgtttgtggccatccggaccatcgggaacatcgtaattgtcaccactctgctgcag
ttcatgttcgcctgcattggggtccagctcttcaagggaaagctctatacctgttcggat
agttctaaacagacggaggcagaatgcaagggtaactatatcacatacaaagatggagag
gtcgatcaccccattatccagcctcgaagctgggagaacagcaagtttgactttgacaat
gttttggcagccatgatggctctcttcaccgtctccaccttcgaagggtggccagagctg
ctgtaccgctccattgactcccacacagaagacaagggccccatctacaactaccgtgtg
gagatctccatcttcttcatcatctatatcatcatcattgccttcttcatgatgaacatc
ttcgtgggtttcgtcattgtcaccttccaggagcagggggaacaagagtacaagaactgt
gagctggacaagaaccagagacaatgtgtggaatatgccctcaaggcccgacccttgcga
aggtacatccccaagaaccagcaccagtacaaagtgtggtacgtggtcaactctacctac
ttcgagtatctgatgttcgttctcatcctgctcaacaccatctgcctggccatgcagcac
tatggccagagctgcctcttcaaaatcgccatgaatatactcaacatgcttttcaccggc
ctcttcacagtggagatgatcctgaagctcattgccttcaaacccaagggttactttagt
gatccctggaatgtttttgacttcctcatcgtcattgggagcataattgatgtcattctc
agtgagactaatccagctgaacatacccaatgctctccctctatgagtgcagaggagaac
tcccgcatctccatcaccttcttccgcctcttccgggtcatgcgcctggtgaagctgctg
agccgcggggaaggcatccgaaccctgctgtggaccttcatcaagtccttccaggctctg
ccctatgtggctcttttgattgtgatgctgttctttatctatgcagtgattgggatgcag
gtgtttgggaagattgccctgaatgacaccacagagatcaatcggaacaacaacttccag
acgttcccccaggctgtgttactgctgttcaggtgtgccaccggagaggcctggcaggac
atcatgctggcctgcatgccaggcaagaagtgtgccccagagtctgagcccagcaacagc
acggaaggggagaccccctgtggcagcagctttgctgtcttctacttcatcagcttctac
atgctctgtgccttcctgatcatcaacctctttgtagctgttatcatggacaactttgac
tacctgactagggattggtctatcctcggtccccatcacctggatgaattcaagagaatc
tgggccgagtatgaccctgaagccaagggtcggatcaaacacttggatgtggtgaccctc
ctccgtcgaattcagcccccactgggttttgggaaattgtgtcctcaccgtgtggcctgc
aaacgcctggtgtccatgaacatgcctctgaacagcgatggcacagtcatgttcaatgct
accctgtttgccctcgtcaggacagccctgaggatcaaaacagaagggaacctagagcaa
gccaatgaggagcttcgggccatcatcaagaaaatctggaagaggactagcatgaagctg
ttggaccaggtggtgccccctgcaggcgatgacgaggtcacagtgggcaagttctatgcc
accttcctgatccaagagtacttcaggaaattcaagaagcgaaaagagcaggggctggtg
ggcaagccctcacaaaggaatgcactgtccctccaggctggcttgcgcaccttgcatgac
attgggcctgagatccggcgggccatctctggggatctgactgctgaggaggagttggac
aaggctatgaaggaggcggtgtctgctgcctccgaagatgacatcttcaggagggctgga
ggcctgttcggcaaccatgtcacctactatcagagtgacagcaggggcaactttcctcag
acgttcgccacccagcgcccactgcacatcaacaagacagggaacaaccaagctgacact
gagtcaccgtcccatgagaagctggtggactccacgttcacccccagcagctactcatcc
acgggctccaatgccaacatcaacaatgccaacaacactgccctgggccgcttcccccat
cccgctggctactccagcacggtcagcactgtggagggccatgggcctcccttgtcccct
gctgtccgagtacaggaggcagcatggaagctcagctctaagaggtgccactcccgagag
agccagggagccacggtgaatcaggagatatttccagatgagacccgcagcgtaaggatg
agtgaagaagccgagtactgcagtgagcccagcctgctctccacagatatgttctcctac
caggaagatgaacaccgacaactgacctgcccagaggaggacaagagggagatccagcca
tctccaaagaggagtttccttcgctctgcctctctaggtcgaagggcctccttccatctg
gaatgtctaaagcgacaaaaggatcaagggggagacatctctcagaagacagccttgccc
ttgcatctggttcatcatcaggcattggcagtggcaggcttgagccccctcctgcagaga
agccattctcctaccacattccccaggccgtgccccacaccccctgtcactccaggcagc
cggggcagacccctacggcccatccctaccctacggctggagggggcagagtccagcgag
aaactcaacagcagcttcccatccatccactgcagctcctggtctgaggagacgacagcc
tgtagtgggagcagcagcatggcccggagagcccggcccgtctccctcaccgtgcccagc
caggctggagctccagggagacagttccatggcagtgccagcagcctggtggaagcggtc
ttgatttcagaaggactgggacagtttgctcaagatcccaagttcatcgaggtcaccacc
caggagctggctgacgcctgcgacatgacaatagaggagatggagaacgccgcagacaac
atcctcagtgggggcgcccagcagagccccaacggcaccctcttaccttttgtgaactgc
agggacccggggcaggacagggctgtggccccagaggacgagagctgcgcatatgccctg
gggcgaggccggagcgaggaggcgctcgcggacagcaggtcctacgtcagcaacctgtag

DBGET integrated database retrieval system