KEGG   Mus musculus (mouse): 12289Help
Entry
12289             CDS       T01002                                 

Gene name
Cacna1d, 8430418G19Rik, C79217, Cach3, Cacn4, Cacnl1a2, Cav1.3, Cchl1a, Cchl1a2, D-LTCC
Definition
(RefSeq) calcium channel, voltage-dependent, L type, alpha 1D subunit
  KO
K04851  
voltage-dependent calcium channel L type alpha-1D
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Insulin secretion
GnRH signaling pathway
Oxytocin signaling pathway
Renin secretion
Aldosterone synthesis and secretion
Type II diabetes mellitus
Carbohydrate digestion and absorption
Alzheimer's disease
Amphetamine addiction
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    12289 (Cacna1d)
   04020 Calcium signaling pathway
    12289 (Cacna1d)
   04024 cAMP signaling pathway
    12289 (Cacna1d)
   04022 cGMP - PKG signaling pathway
    12289 (Cacna1d)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    12289 (Cacna1d)
   04912 GnRH signaling pathway
    12289 (Cacna1d)
   04921 Oxytocin signaling pathway
    12289 (Cacna1d)
   04924 Renin secretion
    12289 (Cacna1d)
   04925 Aldosterone synthesis and secretion
    12289 (Cacna1d)
  Circulatory system
   04260 Cardiac muscle contraction
    12289 (Cacna1d)
   04261 Adrenergic signaling in cardiomyocytes
    12289 (Cacna1d)
   04270 Vascular smooth muscle contraction
    12289 (Cacna1d)
  Digestive system
   04973 Carbohydrate digestion and absorption
    12289 (Cacna1d)
  Nervous system
   04724 Glutamatergic synapse
    12289 (Cacna1d)
   04727 GABAergic synapse
    12289 (Cacna1d)
   04725 Cholinergic synapse
    12289 (Cacna1d)
   04728 Dopaminergic synapse
    12289 (Cacna1d)
   04726 Serotonergic synapse
    12289 (Cacna1d)
   04723 Retrograde endocannabinoid signaling
    12289 (Cacna1d)
  Environmental adaptation
   04713 Circadian entrainment
    12289 (Cacna1d)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    12289 (Cacna1d)
  Substance dependence
   05031 Amphetamine addiction
    12289 (Cacna1d)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    12289 (Cacna1d)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    12289 (Cacna1d)
   05414 Dilated cardiomyopathy (DCM)
    12289 (Cacna1d)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    12289 (Cacna1d)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN alpha-1, CaVx.x
   12289 (Cacna1d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
14 18.43 cM; 14 B
AA seq 2179 aa AA seqDB search
MMMMMMMKKMQHQRQHQEDHANEANYARGTRLPISGEGPTSQPNSSKQTVLSWQAAIDAA
RQAKAAQTMSTSAPPPVGSLSQRKRQQYAKSKKQGNSSNSRPARALFCLSLNNPIRRACI
SIVEWKPFDIFILLAIFANCVALAIYIPFPEDDSNSTNHNLEKVEYAFLIIFTVETFLKI
IAYGLLLHPNAYVRNGWNLLDFVIVIVGLFSVILEQLTKETEGGNHSSGKSGGFDVKALR
AFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHKT
CFFADSDIVAEEDPAPCAFSGNGRQCTANGTECRSGWVGPNGGITNFDNFAFAMLTVFQC
ITMEGWTDVLYWVNDAIGWEWPWVYFVSLIILGSFFVLNLVLGVLSGEFSKEREKAKARG
DFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGGEEGKRNTSMPTSETESVNTENVS
GEGETQGCCGTLWCWWKRRGAAKTGPSGCRRWGQAISKSKLSRRWRRWNRFNRRRCRAAV
KSVTFYWLVIVLVFLNTLTISSEHYNQPDWLTQIQDIANKVLLALFTCEMLVKMYSLGLQ
AYFVSLFNRFDCFVVCGGITETILVELELMSPLGVSVFRCVRLLRIFKVTRHWTSLSNLV
ASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQTKRSTFDNFPQALLTVFQ
ILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVDNLADAES
LNTAQKEEAEEKERKKIARKESLENKKNNKPEVNQIANSDNKVTIDDYQEDAEDKDPYPP
CDVPVGEEEEEEEEDEPEVPAGPRPRRISELNMKEKIAPIPEGSAFFILSKTNPIRVGCH
KLINHHIFTNLILVFIMLSSAALAAEDPIRSHSFRNTILGYFDYAFTAIFTVEILLKMTT
FGAFLHKGAFCRNYFNLLDMLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKG
LKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCTDEAKSNPEECRGLFI
LYKDGDVDSPVVRERIWQNSDFNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENVGP
VYNYRVEISIFFIIYIIIVAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYAL
KARPLRRYIPKNPYQYKFWYVVNSSPFEYMMFVLIMLNTLCLAMQHYEQSKMFNDAMDIL
NMVFTGVFTVEMVLKVIAFKPKGYFSDAWNTFDSLIVIGSIIDVALSEADPSESETIPLP
TATPGNSEESNRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAML
FFIYAVIGMQMFGKVAMRDNNQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPGKL
CDPDSDYNPGEEYTCGSNFAIVYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPH
HLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNS
DGTVMFNATLFALVRTALKIKTEGNLEQANEELRAVIKKIWKKTSMKLLDQVVPPAGDDE
VTVGKFYATFLIQDYFRKFKKRKEQGLVGKYPAKNTTIALQAGLRTLHDIGPEIRRAISC
DLQDDEPEDSKPEEEDVFKRNGALLGNHVNHVNSDRRDSLQQTNTTHRPLHVQRPSMPPA
SDTEKPLFPPAGNSGCHNHHNHNSIGKQAPTSTNANLNNANMSKAAHGKPPSIGNLEHVS
ENGHYSCKHDRELQRRSSIKRTRYYETYIRSESGDEQFPTICREDPEIHGYFRDPRCLGE
QEYFSSEECCEDDSSPTWSRQNYNYYNRYPGSSMDFERPRGYHHPQGFLEDDDSPTGYDS
RRSPRRRLLPPTPPSHRRSSFNFECLRRQSSQDDVLPSPALPHRAALPLHLMQQQIMAVA
GLDSSKAQKYSPSHSTRSWATPPATPPYRDWSPCYTPLIQVDRSESMDQVNGSLPSLHRS
SWYTDEPDISYRTFTPASLTVPSSFRNKNSDKQRSADSLVEAVLISEGLGRYARDPKFVS
ATKHEIADACDLTIDEMESAASTLLNGSVCPRANGDMGPISHRQDYELQDFGPGYSDEEP
DPGREEEDLADEMICITTL
NT seq 6540 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgatgatgatgatgaaaaaaatgcaacatcaacggcagcaccaagaggaccat
gcgaacgaggcaaactatgcaagaggcaccagactccctatttctggtgaaggaccaact
tctcagcccaacagctccaagcaaactgtcctatcttggcaagctgcaatcgatgctgct
agacaggccaaggccgcccagaccatgagcacctctgcacccccacctgtaggatctctc
tcccaaagaaaacgtcagcaatacgccaagagcaaaaaacagggtaactcgtctaacagc
cgacctgcccgtgcccttttctgtttatccctcaataaccccatccgaagagcctgcatt
agtatagtggaatggaaaccatttgacatatttatattattggctatttttgccaattgt
gtggccttagctatttacatcccattccctgaagatgattctaattcaacaaatcataac
ttggaaaaagtagaatatgccttcctgattatttttacagtggagacatttctgaagatt
atagcgtatggactgttgctgcatcctaatgcttacgttaggaatggatggaatttactg
gattttgttatagtaattgtaggattgtttagtgtaattctggaacaattaaccaaagaa
acagaaggcgggaaccactctagtggcaaatcaggaggctttgatgtcaaagccctccgt
gccttccgagtgttaagaccacttcgacttgtatcaggagtgcccagtttacaagttgtt
ctgaactccattataaaagccatggtccccctccttcacatagcccttttggtattattt
gtaattatcatctatgctattataggattggaactttttattggaaaaatgcacaaaaca
tgtttttttgctgactcagatatagtagctgaagaggacccagctccgtgtgcgttctca
gggaatggacgccagtgcaccgccaatggcacggaatgtaggagtggctgggttggcccc
aatggaggcatcactaactttgataactttgcctttgccatgctcactgtgttccagtgc
attaccatggagggctggacagatgtgctctactgggttaatgatgcgataggatgggaa
tggccatgggtgtattttgttagtctgatcatccttggctcatttttcgtccttaacctg
gttcttggtgtccttagtggagaattctccaaggaaagagagaaggctaaagctcgtgga
gatttccagaagcttcgggaaaaacagcagctggaagaggacctcaagggctacctggac
tggatcacccaggcagaagacatcgatcccgagaacgaggaggagggtggcgaggaaggc
aaacgaaacactagcatgcccaccagcgagactgaatctgtcaacacagagaacgtaagt
ggtgaaggcgagacccagggatgctgtggaactctctggtgctggtggaaaagaagaggc
gcggccaagaccgggccctctgggtgtcggcggtggggtcaggccatctcgaaatccaaa
ctcagccgtcgatggcgtcgctggaaccggttcaatcgcaggaggtgcagggctgccgtg
aagtctgtcacgttttactggctggtgattgtcctggtgtttctcaacactttaactatt
tcctctgagcattacaatcagccagactggctgacacagattcaagacatcgcaaacaaa
gtcctcttggctctgttcacctgtgagatgctggtgaagatgtacagcctgggcctccag
gcttactttgtctccctcttcaaccgcttcgattgctttgtggtgtgtgggggcatcacc
gaaaccatcctggtggaactggagctcatgtctcccctgggggtctccgtgttccggtgt
gtgcgcctcctgagaatcttcaaagtgaccaggcactggacctccctgagcaacttggtg
gcatccttgttaaactccatgaagtccatcgcctctctgctgttactcctcttcctcttc
atcatcatcttctccttgctggggatgcagttgtttggtgggaagtttaattttgacgag
actcaaaccaagcgaagcacctttgacaactttccgcaagcactcctgacggtgttccag
atcctgacaggtgaagactggaatgcggtgatgtatgacggcatcatggcctatggaggc
ccttcctcttccgggatgattgtctgtatctacttcatcatccttttcatctgtggtaac
tatatcctgctgaatgtcttcttggccatcgctgtggacaatttggctgatgctgaaagt
ctgaacactgctcagaaagaggaagctgaagaaaaagaaaggaaaaagattgccagaaaa
gaaagcctagaaaacaaaaagaacaacaaaccagaagtcaaccagatagccaacagtgac
aacaaggttacaattgatgattatcaggaagatgctgaagacaaggacccttacccgccc
tgtgatgtgccagtaggtgaagaggaagaggaggaggaagaggatgagcccgaagttcct
gctggtccccgccctcgcagaatctcagagttgaacatgaaggagaagattgcgcccatc
ccagaaggaagcgccttcttcattcttagcaagaccaacccgatacgtgtgggttgccac
aagctcattaaccaccacatcttcaccaaccttatcctggtcttcatcatgctgagcagc
gctgccctggctgcagaggaccccatccgtagccactcattccgcaacacgatactgggc
tactttgactatgccttcacagccatctttacggttgaaatcctgttaaagatgacaact
tttggagccttcttgcacaaaggggctttctgcaggaactacttcaatttgctggacatg
ctggttgttggggtgtcgctggtgtcctttgggattcagtccagcgccatctccgttgtg
aagattctgagggttttgagggtcttgcggcctctcagagcaatcaacagagcaaaggga
cttaagcacgtggtccagtgtgtctttgtggccatccgaaccattggcaacatcatgatc
gtcacgaccctgctccagttcatgtttgcatgcattggggtccagctgttcaaggggaag
ttctaccgttgcacagatgaagccaaaagtaaccctgaggagtgcagggggcttttcatt
ctttataaggacggcgatgttgacagtcctgtggtccgtgagaggatctggcaaaatagt
gatttcaattttgacaatgtcctttcggctatgatggcgctgttcacagtctcaactttt
gagggctggcccgcgttgctgtacaaagctattgattcaaacggtgagaacgttggtcct
gtctacaactaccgtgtggagatctccatcttcttcatcatctacatcatcatcgttgcc
ttcttcatgatgaacatctttgtgggcttcgtcatcgtcaccttccaggaacagggagaa
aaagagtataagaactgtgagctggacaaaaatcagcgtcagtgtgttgaatatgccttg
aaagcacgccccttaaggagatacatccccaaaaacccataccagtacaagttctggtat
gtggtgaactcctcgcctttcgaatacatgatgttcgtcctcatcatgctcaacacgctc
tgcctggccatgcagcactatgagcagtccaagatgttcaatgatgccatggacattctg
aacatggtcttcacaggggtcttcactgttgagatggttttgaaagtcattgctttcaag
cccaaggggtattttagtgacgcctggaacacgtttgactccctcatcgtaatcggcagc
attatagacgtggccctcagcgaagccgacccatctgaaagtgagactatccctctccca
actgccacacctgggaactctgaagagagcaatagaatctccatcacctttttccgtctt
ttccgagtgatgcggttggtgaaacttctcagcaggggggaaggcatccggacactgctg
tggaccttcatcaagtcctttcaggcgctgccgtatgttgccctcctcattgccatgctc
ttcttcatctacgctgtcataggcatgcagatgtttgggaaagttgccatgagagataac
aaccagatcaataggaacaacaacttccagacctttcctcaggcagtgctcctactcttc
aggtgtgcaacaggggaagcctggcaggagatcatgcttgcctgcctcccaggaaagctg
tgcgacccagactccgattacaacccaggagaggagtacacttgtgggagcaactttgcc
attgtctacttcatcagcttttacatgctctgtgcattcctgatcatcaacctctttgtg
gctgtcatcatggacaattttgactatctgactcgggactggtctattctggggcctcac
cacttggacgaattcaaaagaatatggtcagaatatgaccctgaagcaaagggaaggata
aaacaccttgatgtggtcactctgctccggcggatccagcctcccctggggtttggaaaa
ttatgcccacaccgagtagcatgtaagagattggttgccatgaacatgcctctcaacagt
gatgggacagtcatgttcaatgcaaccctgtttgctttggtccggacagctctcaagatc
aagactgaagggaacctggagcaagctaatgaagaactccgagctgtgatcaagaaaatc
tggaagaagacaagcatgaagctgcttgaccaagttgtccctccagctggtgatgatgag
gtaaccgtggggaagttctatgccactttcctgatacaggactactttaggaaattcaag
aaacggaaagagcaaggactggtggggaagtaccctgcgaagaacaccacgattgcccta
caggcgggattaaggaccctgcatgacattgggccagaaatccgacgggctatatcctgt
gacttgcaagatgacgagccagaagactccaaaccagaagaagaagatgtattcaaaaga
aatggtgccctgcttggaaaccatgtcaatcatgttaatagtgataggagagattccctt
cagcagaccaataccacccaccgtcccctgcatgtccaaaggccttcaatgccacctgca
agtgatactgagaaaccgctgtttcctccagcaggaaattcggggtgtcataaccatcat
aaccataattccatagggaagcaagctcccacctcaacaaatgccaatctcaataatgcc
aatatgtccaaagctgcccacggaaagccgcccagcattgggaaccttgagcatgtgtct
gaaaatgggcattactcctgcaagcatgatcgagagcttcaaagaaggtccagtattaaa
agaacccgctattacgagacttacattaggtctgagtcaggagatgagcaatttccaacc
atttgccgtgaagatcctgagatacacggctacttccgagacccccgctgcttgggggaa
caggagtatttcagtagcgaggagtgctgtgaggacgacagctctcccacctggagcagg
caaaactacaactactacaacaggtacccaggcagctccatggactttgagaggccccga
ggctaccaccacccccaaggcttcttagaagatgatgactctcccactggctatgattca
cggagatctccgaggagacgtcttctacctcctaccccaccatcccatcggaggtcctcc
ttcaactttgagtgtctgcgcaggcaaagcagccaagacgatgtccttccatcgcctgcc
ctgcctcaccgcgctgccctgcccctgcacctgatgcagcagcagatcatggccgttgca
ggcctagattccagtaaagcccagaagtactcaccgagccactctacccggtcgtgggcc
acccctccagcaacccctccataccgagactggagcccatgctacacccctttgatccag
gtggaccgctcagaatctatggaccaggtcaatggcagcctgccatccctacaccgaagc
tcctggtacacagatgaacccgacatctcctataggactttcacgccagctagtctgact
gtccccagcagcttccggaacaagaacagcgacaagcagaggagtgcagacagcctggtg
gaggcagtcctgatatccgaaggcttgggacgctacgcgagggaccccaaatttgtctca
gcgacaaaacatgagattgccgatgcctgtgacctaaccatagacgagatggaaagtgct
gccagcaccctgctcaatggcagtgtgtgtcctcgagccaatggggacatgggccccatc
tcccaccgccaggactatgagctccaggactttggtcctggctacagtgacgaggagcca
gaccctgggcgagaggaagaggacctggcagatgagatgatttgcattaccaccttgtag

DBGET integrated database retrieval system