KEGG   Mus musculus (mouse): 12304Help
Entry
12304             CDS       T01002                                 

Gene name
Pdia4, AI987846, Cai, ERp-72, Erp72
Definition
protein disulfide isomerase associated 4 (EC:5.3.4.1)
Orthology
K09582  
protein disulfide-isomerase A4 [EC:5.3.4.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Protein processing in endoplasmic reticulum
Thyroid hormone synthesis
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:mmu04141]
Organismal Systems; Endocrine system; Thyroid hormone synthesis [PATH:mmu04918]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
6 B2.3; 6 22.94 cM
AA seq 641 aa AA seqDB search
MKLRKAWLLVLLLALTQLLAAASAGDAHEDTSDTENATEEEEEEEEEDDDDLEVKEENGV
WVLNDGNFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIASTLKDNDPPIAVAKIDATS
ASMLASKFDVSGYPTIKILKKGQAVDYDGSRTQEEIVAKVREVSQPDWTPPPEVTLSLTK
DNFDDVVNNADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATEQTDLA
KRFDVSGYPTLKIFRKGRPFDYNGPREKYGIVDYMIEQSGPPSKEILTLKQVQEFLKDGD
DVVIIGLFQGDGDPAYLQYQDAANNLREDYKFHHTFSPEIAKFLKVSLGKLVLTHPEKFQ
SKYEPRFHVMDVQGSTEASAIKDYVVKHALPLVGHRKTSNDAKRYSKRPLVVVYYSVDFS
FDYRAATQFWRNKVLEVAKDFPEYTFAIADEEDYATEVKDLGLSESGEDVNAAILDESGK
KFAMEPEEFDSDTLREFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDAIVMDPKK
DVLIEFYAPWCGHCKQLEPIYTSLGKKYKGQKDLVIAKMDATANDITNDQYKVEGFPTIY
FAPSGDKKNPIKFEGGNRDLEHLSKFIDEHATKRSRTKEEL
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgaagctccggaaagcttggctgttggtcctgctcttggcgctgacacagctgctggct
gctgcgagcgccggagatgcacacgaagatacttcagatacagaaaatgccactgaggag
gaagaggaggaagaggaagaggatgacgatgacttggaagttaaggaagaaaatggtgtt
tgggtcttaaatgatgggaactttgataactttgtggctgacaaagatacagtgctactg
gagttctatgcaccatggtgtggacactgcaagcagtttgctccagaatatgagaaaatt
gccagtactttgaaggataatgatcctcccattgctgtagcgaagatcgatgcaacctca
gcatccatgctagccagcaaatttgatgtgagtggctaccccaccatcaagatcctgaag
aagggacaggccgttgactatgatggctccaggacccaggaagaaattgttgccaaagtc
agagaagtttcccagcctgattggacacctccacctgaagtcactctttcattgactaaa
gataactttgacgatgttgtaaataatgcagacattattttggtggagttctatgccccg
tggtgtggacactgcaagaaacttgcccctgagtatgagaaagctgccaaggagctcagc
aagcgctctcccccaattcccttagccaaagtggacgccaccgaacagacagacctggct
aagaggtttgatgtctctggctacccgactttgaaaattttccgcaaaggaaggcctttt
gactacaatggcccacgagagaaatatgggattgttgactacatgattgagcagtctggg
cctccctcaaaggagatcctgaccctgaagcaggtccaggagttcctgaaggatggagat
gatgtggtcatcattgggctctttcagggagatggtgacccggcctacttgcagtatcag
gatgctgctaacaacctgagagaagattacaagtttcaccacactttcagccctgaaata
gccaagttcctgaaagtctccctggggaagttggtgctgacacaccctgagaagttccag
tccaagtatgagcccaggttccacgtgatggatgttcagggctctacagaagcatcagcc
attaaggactatgtagtgaaacatgccttgcccctggtgggccatcgtaagacttctaat
gatgctaagcggtacagcaaacgccccctggtggttgtatactacagtgtggacttcagc
tttgattacagagctgctactcagttttggcgtaacaaagtcctagaggtggccaaggac
ttccctgagtataccttcgccattgctgacgaggaagactatgccacggaggtgaaggac
ctggggctcagtgagagtggagaggatgtcaatgcagccatcctagacgagagcgggaag
aagtttgccatggagccagaggagtttgattcagacactctccgggaatttgtcacagct
tttaaaaaaggaaaactaaagccagtcatcaaatcacagccagtacccaagaacaacaag
ggaccagtcaaggtggtggtgggaaagacctttgatgccattgtgatggaccccaaaaag
gacgtcctcattgaattctatgcaccctggtgtgggcactgcaagcagctagagcctatc
tataccagcctaggcaagaaatacaagggccagaaggacctggtcatcgccaagatggat
gctactgccaacgacatcaccaacgaccaatataaggtggagggcttccctaccatctat
tttgctcccagtggggacaaaaagaacccaattaaatttgagggtggcaacagagatctg
gagcatttgagcaagtttatagatgaacatgccacaaagaggagcaggaccaaggaagag
ctttaa

DBGET integrated database retrieval system