KEGG   Mus musculus (mouse): 12304Help
Entry
12304             CDS       T01002                                 

Gene name
Pdia4, AI987846, Cai, ERp-72, Erp72
Definition
protein disulfide isomerase associated 4 (EC:5.3.4.1)
Orthology
K09582  
protein disulfide-isomerase A4 [EC:5.3.4.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Protein processing in endoplasmic reticulum
Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    12304 (Pdia4)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    12304 (Pdia4)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     12304 (Pdia4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
6 B2.3; 6 22.94 cM
AA seq 641 aa AA seqDB search
MKLRKAWLLVLLLALTQLLAAASAGDAHEDTSDTENATEEEEEEEEEDDDDLEVKEENGV
WVLNDGNFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIASTLKDNDPPIAVAKIDATS
ASMLASKFDVSGYPTIKILKKGQAVDYDGSRTQEEIVAKVREVSQPDWTPPPEVTLSLTK
DNFDDVVNNADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATEQTDLA
KRFDVSGYPTLKIFRKGRPFDYNGPREKYGIVDYMIEQSGPPSKEILTLKQVQEFLKDGD
DVVIIGLFQGDGDPAYLQYQDAANNLREDYKFHHTFSPEIAKFLKVSLGKLVLTHPEKFQ
SKYEPRFHVMDVQGSTEASAIKDYVVKHALPLVGHRKTSNDAKRYSKRPLVVVYYSVDFS
FDYRAATQFWRNKVLEVAKDFPEYTFAIADEEDYATEVKDLGLSESGEDVNAAILDESGK
KFAMEPEEFDSDTLREFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDAIVMDPKK
DVLIEFYAPWCGHCKQLEPIYTSLGKKYKGQKDLVIAKMDATANDITNDQYKVEGFPTIY
FAPSGDKKNPIKFEGGNRDLEHLSKFIDEHATKRSRTKEEL
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgaagctccggaaagcttggctgttggtcctgctcttggcgctgacacagctgctggct
gctgcgagcgccggagatgcacacgaagatacttcagatacagaaaatgccactgaggag
gaagaggaggaagaggaagaggatgacgatgacttggaagttaaggaagaaaatggtgtt
tgggtcttaaatgatgggaactttgataactttgtggctgacaaagatacagtgctactg
gagttctatgcaccatggtgtggacactgcaagcagtttgctccagaatatgagaaaatt
gccagtactttgaaggataatgatcctcccattgctgtagcgaagatcgatgcaacctca
gcatccatgctagccagcaaatttgatgtgagtggctaccccaccatcaagatcctgaag
aagggacaggccgttgactatgatggctccaggacccaggaagaaattgttgccaaagtc
agagaagtttcccagcctgattggacacctccacctgaagtcactctttcattgactaaa
gataactttgacgatgttgtaaataatgcagacattattttggtggagttctatgccccg
tggtgtggacactgcaagaaacttgcccctgagtatgagaaagctgccaaggagctcagc
aagcgctctcccccaattcccttagccaaagtggacgccaccgaacagacagacctggct
aagaggtttgatgtctctggctacccgactttgaaaattttccgcaaaggaaggcctttt
gactacaatggcccacgagagaaatatgggattgttgactacatgattgagcagtctggg
cctccctcaaaggagatcctgaccctgaagcaggtccaggagttcctgaaggatggagat
gatgtggtcatcattgggctctttcagggagatggtgacccggcctacttgcagtatcag
gatgctgctaacaacctgagagaagattacaagtttcaccacactttcagccctgaaata
gccaagttcctgaaagtctccctggggaagttggtgctgacacaccctgagaagttccag
tccaagtatgagcccaggttccacgtgatggatgttcagggctctacagaagcatcagcc
attaaggactatgtagtgaaacatgccttgcccctggtgggccatcgtaagacttctaat
gatgctaagcggtacagcaaacgccccctggtggttgtatactacagtgtggacttcagc
tttgattacagagctgctactcagttttggcgtaacaaagtcctagaggtggccaaggac
ttccctgagtataccttcgccattgctgacgaggaagactatgccacggaggtgaaggac
ctggggctcagtgagagtggagaggatgtcaatgcagccatcctagacgagagcgggaag
aagtttgccatggagccagaggagtttgattcagacactctccgggaatttgtcacagct
tttaaaaaaggaaaactaaagccagtcatcaaatcacagccagtacccaagaacaacaag
ggaccagtcaaggtggtggtgggaaagacctttgatgccattgtgatggaccccaaaaag
gacgtcctcattgaattctatgcaccctggtgtgggcactgcaagcagctagagcctatc
tataccagcctaggcaagaaatacaagggccagaaggacctggtcatcgccaagatggat
gctactgccaacgacatcaccaacgaccaatataaggtggagggcttccctaccatctat
tttgctcccagtggggacaaaaagaacccaattaaatttgagggtggcaacagagatctg
gagcatttgagcaagtttatagatgaacatgccacaaagaggagcaggaccaaggaagag
ctttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system