KEGG   Mus musculus (mouse): 12306Help
Entry
12306             CDS       T01002                                 

Gene name
Anxa2, AW215814, Cal1h
Definition
(RefSeq) annexin A2
  KO
K17092  
annexin A2
Organism
mmu  Mus musculus (mouse)
Brite
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   12306 (Anxa2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9 C; 9 38.58 cM
AA seq 339 aa AA seqDB search
MSTVHEILCKLSLEGDHSTPPSAYGSVKPYTNFDAERDALNIETAVKTKGVDEVTIVNIL
TNRSNVQRQDIAFAYQRRTKKELPSALKSALSGHLETVILGLLKTPAQYDASELKASMKG
LGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRA
EDGSVIDYELIDQDARELYDAGVKRKGTDVPKWISIMTERSVCHLQKVFERYKSYSPYDM
LESIKKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDM
LKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgtctactgtccacgaaatcctgtgcaagctcagcctggagggtgatcattctacaccc
ccaagtgcctacgggtcagtcaaaccctacaccaacttcgatgctgagagggatgctctg
aacattgagacagcagtcaagaccaaaggagtggatgaggtcaccattgtcaacatcctg
acaaaccgcagcaatgtgcagaggcaggacattgccttcgcctatcagagaaggaccaaa
aaggagctcccgtcagcgctgaagtcagccttatctggccacctggagacggtgattttg
ggcctattgaagacacctgcccagtatgatgcttcggaactaaaagcttccatgaagggc
ctggggactgacgaggactccctcattgagatcatctgctcacgaaccaaccaggagctg
caagagatcaacagagtgtacaaggaaatgtacaagactgatctggagaaggacatcatc
tctgacacatctggagacttccgaaagctgatggtcgcccttgcaaagggcagacgagca
gaggatggctcagttattgactacgagctgattgaccaggatgcccgggagctctatgat
gccggggtgaagaggaaaggaaccgacgtccccaagtggatcagcatcatgactgagcgc
agtgtgtgccacctccagaaagtgttcgaaaggtacaagagctacagcccttatgacatg
ctggagagcatcaagaaagaggtcaaaggggacctggagaacgccttcctgaacctggtc
cagtgcatccagaacaagcccctgtacttcgctgaccggctgtacgactccatgaagggc
aaggggactcgagacaaggtcctgattagaatcatggtctctcgcagtgaagtggacatg
ctgaaaatcagatctgaattcaagaggaaatatggcaagtccctgtactactacatccag
caagacaccaagggtgactaccagaaggcactgctgtacctgtgtggtggggatgactga

DBGET integrated database retrieval system