KEGG   Mus musculus (mouse): 12309Help
Entry
12309             CDS       T01002                                 

Gene name
S100g, AU042539, CABP1, CaBP-D9K, Cabp9k, Calb3
Definition
(RefSeq) S100 calcium binding protein G
  KO
K14734  
S100 calcium binding protein G
Organism
mmu  Mus musculus (mouse)
Pathway
Mineral absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Digestive system
   04978 Mineral absorption
    12309 (S100g)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
X; X F4
AA seq 79 aa AA seqDB search
MCAEKSPAEMKSIFQKYAAKEGDPDQLSKEELKLLIQSEFPSLLKASSTLDNLFKELDKN
GDGEVSYEEFEAFFKKLSQ
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgctgagaagtctcctgcagaaatgaagagcatttttcaaaaatatgcagccaag
gaaggcgatccggaccagctctccaaggaggagctaaagctgctgattcagtcagagttc
cccagcctcctgaaggcttcaagtactctggacaatctctttaaggagctggataagaat
ggcgatggagaagttagttacgaagaattcgaagctttcttcaaaaagctctcacaatga

DBGET integrated database retrieval system