KEGG   Mus musculus (mouse): 12317Help
Entry
12317             CDS       T01002                                 

Gene name
Calr, CRT, Calregulin
Definition
(RefSeq) calreticulin
  KO
K08057  
calreticulin
Organism
mmu  Mus musculus (mouse)
Pathway
Protein processing in endoplasmic reticulum
Phagosome
Antigen processing and presentation
Chagas disease (American trypanosomiasis)
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    12317 (Calr)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    12317 (Calr)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    12317 (Calr)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    12317 (Calr)
   05142 Chagas disease (American trypanosomiasis)
    12317 (Calr)
Chaperones and folding catalysts [BR:mmu03110]
 Other chaperones and cochaperones
  Calnexin / calreticulin
   12317 (Calr)
Lectins [BR:mmu04091]
 Calnexin / calreticulin
  12317 (Calr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8 C3; 8 41.21 cM
AA seq 416 aa AA seqDB search
MLLSVPLLLGLLGLAAADPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDL
EKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQK
DMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDN
TYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPE
HIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYS
PDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDK
QDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgctcctttcggtgccgctcctgcttggcctcctcggcctggccgccgcagaccctgcc
atctatttcaaagagcagttcttggacggagatgcctggaccaaccgctgggtcgaatcc
aaacataagtccgattttggcaaatttgtcctcagttctggcaaattttacggggacctg
gagaaggataaagggctgcagacaagccaagatgcccgattttacgcactgtccgccaaa
ttcgaacccttcagcaataagggccagacactggtggtacagttcacggtgaagcatgag
cagaatatcgactgtgggggcggctacgtgaagctgtttccgagtggtttggaccagaag
gacatgcatggagactcagaatataacatcatgtttggtccggacatctgcggtcctggc
accaagaaggttcatgtcatctttaactacaagggcaagaatgtgctgatcaacaaggat
atccggtgtaaggatgatgaattcacacacctatacacactgattgtgcggccagacaac
acctatgaggtgaaaattgacaacagccaggtggagtcaggctccttggaggatgattgg
gactttctgccacccaagaagataaaggaccctgatgctgccaagccggaagactgggat
gaacgagccaagatcgatgaccccacagattccaagcctgaggactgggacaagccagag
cacatccctgaccctgatgctaagaagcctgaggactgggatgaagagatggatggagag
tgggaaccaccagtgattcaaaatcctgaatacaagggcgagtggaaaccacgtcaaatt
gacaacccagattacaagggtacctggatacacccagaaattgacaaccctgaatactcc
cccgatgcaaatatctatgcctatgatagttttgctgtactgggcctagatctctggcag
gtcaagtccgggacaatctttgacaatttcctcatcaccaatgatgaggcctatgcagag
gagtttggcaatgagacgtggggtgttaccaaggctgcagagaagcagatgaaggacaag
caggatgaggagcagaggcttaaggaagaagaagaggacaagaagcgtaaagaggaagaa
gaagctgaggataaagaggatgatgatgacagagatgaagatgaggacgaagaagatgag
aaggaggaagatgaggaagaatcccctggccaagccaaggatgagctgtag

DBGET integrated database retrieval system