KEGG   Mus musculus (mouse): 12330Help
Entry
12330             CDS       T01002                                 

Gene name
Canx, 1110069N15Rik, AI988026, Cnx, D11Ertd153e
Definition
(RefSeq) calnexin
  KO
K08054  
calnexin
Organism
mmu  Mus musculus (mouse)
Pathway
Protein processing in endoplasmic reticulum
Phagosome
Antigen processing and presentation
Thyroid hormone synthesis
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    12330 (Canx)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    12330 (Canx)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    12330 (Canx)
  Endocrine system
   04918 Thyroid hormone synthesis
    12330 (Canx)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    12330 (Canx)
Chaperones and folding catalysts [BR:mmu03110]
 Other chaperones and cochaperones
  Calnexin / calreticulin
   12330 (Canx)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    12330 (Canx)
Lectins [BR:mmu04091]
 Calnexin / calreticulin
  12330 (Canx)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 B1.3; 11 30.46 cM
AA seq 591 aa AA seqDB search
MEGKWLLCLLLVLGTAAVEAHDGHDDDAIDIEDDLDDVIEEVEDSKSKSDASTPPSPKVT
YKAPVPTGEVYFADSFDRGSLSGWILSKAKKDDTDDEIAKYDGKWEVDEMKETKLPGDKG
LVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTAELSLDQF
HDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGVYEEKHAKRPDADLKTYFTDKKTHLYT
LILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIADPDAV
KPDDWDEDAPSKIPDEEATKPEGWLDDEPEYIPDPDAEKPEDWDEDMDGEWEAPQIANPK
CESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFKMTPF
SAIGLELWSMTSDIFFDNFIISGDRRVVDDWANDGWGLKKAADGAAEPGVVLQMLEAAEE
RPWLWVVYILTVALPVFLVILFCCSGKKQSNAMEYKKTDAPQPDVKDEEGKEEEKNKRDE
EEEEEKLEEKQKSDAEEDGVTGSQDEEDSKPKAEEDEILNRSPRNRKPRRE
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggaagggaagtggttactgtgtttgctgctggtccttggaactgcagctgttgaggct
catgatggacatgatgatgacgcgattgatattgaagatgatcttgatgatgttattgaa
gaggtagaagattcaaaatctaaatcagatgccagcactcctccatctccaaaggtcacc
tacaaagctccagttccaacaggggaggtttattttgctgactcctttgacagagggtct
ctgtcagggtggattttatctaaagccaaaaaagatgacactgatgatgaaattgccaaa
tatgatggaaagtgggaagtagatgagatgaaggaaacaaagcttccaggggataaagga
cttgtactgatgtctcgggccaagcatcatgccatctctgctaaactgaataagcccttc
ctgtttgataccaagcctctcattgttcagtatgaggttaattttcagaatggaatagaa
tgtggtggtgcctatgtgaagctgctttccaagacggcagagctcagcctggatcaattc
cacgacaagactccctatactattatgtttggtccagataagtgtggagaggactacaaa
ctgcatttcatctttcgacacaaaaatcccaagacaggtgtatatgaagaaaaacatgct
aagaggccagatgcagatctgaagacctatttcactgacaagaaaacgcatctttataca
ttaatcttgaatccagacaatagttttgaaatattagttgaccagtctgttgtgaacagt
ggaaatctgctaaatgacatgactcctcctgtaaacccttcacgtgaaattgaagaccca
gaagaccggaagcctgaagattgggatgaaaggcccaaaatagcagatccagatgctgtc
aagccagatgactgggatgaagacgccccttctaagatcccagatgaagaggccaccaag
cctgaaggctggctagacgacgaacctgagtatattccagaccctgatgcagagaagcca
gaggattgggatgaggatatggacggagaatgggaggctcctcagattgccaaccccaag
tgtgagtcagcccctgggtgtggtgtctggcagcgacctatgattgacaaccccaattat
aagggcaaatggaagcctccaatgattgacaaccctaactaccagggaatctggaaacca
aggaaaataccaaatccagatttctttgaagacctagaaccttttaagatgactcctttc
agtgctattggtttggagctctggtccatgacatccgacatcttttttgacaactttatc
attagtggtgaccgaagagtagttgatgattgggccaatgatgggtggggcctgaagaaa
gctgctgatggggctgctgagccaggtgtagtgctgcagatgctggaggcagctgaagag
cgtccatggctttgggtggtctacattttgactgtagctttgccagtgttccttgtgatc
ctcttctgctgttctggaaagaaacagtccaatgctatggagtacaagaagacggatgct
ccccagccagatgtgaaggatgaagaagggaaggaagaagagaagaacaagagggatgaa
gaggaagaagaggagaagcttgaagagaaacagaagagtgatgctgaagaagatggtgtt
actggcagtcaagatgaggaagatagcaagcctaaagcagaggaggatgaaattttgaac
agatcgccaagaaacagaaagccacgaagagagtga

DBGET integrated database retrieval system