KEGG   Mus musculus (mouse): 12334Help
Entry
12334             CDS       T01002                                 

Gene name
Capn2, AI326419, Capa-2, Capa2, m-calpain, m-calpin
Definition
(RefSeq) calpain 2 (EC:3.4.22.53)
  KO
K03853  
calpain-2 [EC:3.4.22.53]
Organism
mmu  Mus musculus (mouse)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Focal adhesion
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    12334 (Capn2)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    12334 (Capn2)
  Cellular community
   04510 Focal adhesion
    12334 (Capn2)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    12334 (Capn2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.53  calpain-2
     12334 (Capn2)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C2: calpain family
   12334 (Capn2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1; 1 H5
AA seq 700 aa AA seqDB search
MAGIAIKLAKDREAAEGLGSHERAIKYLNQDYETLRNECLEAGALFQDPSFPALPSSLGY
KELGPYSSKTRGIEWKRPTEICADPQFIIGGATRTDICQGALGDCWLLAAIASLTLNEEI
LARVVPPDQSFQENYAGIFHFQFWQYGEWVEVVVDDRLPTKDGELLFVHSAEGSEFWSAL
LEKAYAKINGCYEALSGGATTEGFEDFTGGIAEWYELRKPPPNLFKIIQKALEKGSLLGC
SIDITSAADSEAVTYQKLVKGHAYSVTGAEEVESSGSLQKLIRIRNPWGQVEWTGKWNDN
CPSWNTVDPEVRANLTERQEDGEFWMSFSDFLRHYSRLEICNLTPDTLTCDSYKKWKLTK
MDGNWRRGSTAGGCRNYPNTFWMNPQYLIKLEEEDEDEEDGERGCTFLVGLIQKHRRRQR
KMGEDMHTIGFGIYEVPEELTGQTNIHLGKNFFLTTRARERSDTFINLREVLNRFKLPPG
EYVLVPSTFEPHKDGDFCIRVFSEKKADYQAVDDEIEANIEEIDANEEDIDDGFRRLFVQ
LAGEDAEISAFELQTILRRVLAKRQDIKSDGFSIETCKIMVDMLDEDGSGKLGLKEFYIL
WTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKLPCQLHQVIVARFADDELIIDFD
NFVRCLVRLETLFKIFKQLDPENTGTIQLNLASWLSFSVL
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcatcgcgataaagctggccaaggaccgcgaagcggccgaggggctggggtcg
catgagagagccatcaagtacctcaaccaggactacgagacgctgcggaacgagtgcctg
gaggccggggcgctcttccaggatccttccttccccgccctgccgtcatccttgggctat
aaggagttggggccctactccagcaaaactcggggcatcgaatggaagcggcccacggag
atctgcgctgacccccagttcattattggaggagccacccgcacagacatctgccaagga
gccctgggggactgctggctgctggctgccatcgcctccctcaccttgaatgaggaaatc
ctggctcgggttgtgcctccagatcagagcttccaggaaaactatgcaggcatcttccac
ttccagttctggcaatatggcgagtgggtggaggtggtggtggacgacaggctgcccact
aaggacggggagctgctctttgtgcattcagctgaagggagtgagttctggagtgccctt
ctggagaaagcctatgccaagatcaatgggtgctatgaagcactctcagggggtgccacc
acggaaggctttgaagacttcacaggaggcattgctgagtggtatgagctgaggaagcct
cctcccaacttgttcaagatcatccagaaggctttggagaaaggttctctgcttggctgc
tctatcgatatcaccagcgctgcagattctgaggccgttacgtaccagaagttggtgaaa
ggacatgcgtactctgtcaccggagccgaggaggttgaaagttcaggaagcctgcagaaa
ttgatccgcatcaggaatccctggggacaagtagagtggaccgggaagtggaatgacaat
tgccccagctggaacacggttgacccagaagtaagggcaaatctaaccgaacggcaggag
gacggagaattctggatgtccttcagtgacttcctgagacactactctcgcctggagatc
tgcaacctgaccccggacaccctcacctgtgactcctataagaagtggaaactcaccaag
atggatgggaactggaggcgaggctccaccgcagggggctgcaggaattacccaaatacc
ttctggatgaaccctcagtacctaattaagctggaggaagaagacgaagatgaggaggat
ggggagagaggctgtaccttcctggtgggtctcatccagaagcaccggcgacggcagagg
aagatgggcgaggacatgcacaccattggcttcggcatctatgaggttccagaggagcta
acagggcagaccaacatccacctcggcaaaaactttttcctcacaacccgagccagggag
cggtcagataccttcattaacctccgcgaggtcctcaaccgcttcaagctgcccccggga
gagtatgtcctcgttccctccaccttcgaaccccacaaggatggcgatttctgcatccga
gtcttctcggagaagaaggctgactaccaagctgttgatgacgagatcgaggccaacatt
gaagagattgacgccaatgaggaggacattgacgatggattccgaaggctctttgttcag
ctggctggagaggatgcagagatctctgcctttgagctgcagaccatcttaagaagagtt
ctagccaaacgccaagacatcaagtcagacggcttcagcatcgagacctgtaagatcatg
gtggacatgctggatgaagatgggagtggcaagcttggcctgaaggagttctacatcctc
tggacgaagattcagaaataccaaaaaatctaccgggaaatcgatgtggacaggtctgga
accatgaattcctacgagatgcggaaagcactggaagaagcaggtttcaagctgccctgt
caacttcatcaagtcatcgttgcccggtttgcagacgacgagctaatcatcgactttgac
aattttgtgcggtgtttggtccgtctggaaacgctattcaagatattcaagcagctagac
cctgagaacactggaacgatacagctcaaccttgcttcgtggctgagtttttcagtactc
tga

DBGET integrated database retrieval system