KEGG   Mus musculus (mouse): 12334Help
Entry
12334             CDS       T01002                                 

Gene name
Capn2, AI326419, Capa-2, Capa2, m-calpain, m-calpin
Definition
(RefSeq) calpain 2
  KO
K03853  
calpain-2 [EC:3.4.22.53]
Organism
mmu  Mus musculus (mouse)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Focal adhesion
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    12334 (Capn2)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    12334 (Capn2)
  Cellular community - eukaryotes
   04510 Focal adhesion
    12334 (Capn2)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    12334 (Capn2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.53  calpain-2
     12334 (Capn2)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C2: calpain family
   12334 (Capn2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1; 1 H5
AA seq 700 aa AA seqDB search
MAGIAIKLAKDREAAEGLGSHERAIKYLNQDYETLRNECLEAGALFQDPSFPALPSSLGY
KELGPYSSKTRGIEWKRPTEICADPQFIIGGATRTDICQGALGDCWLLAAIASLTLNEEI
LARVVPPDQSFQENYAGIFHFQFWQYGEWVEVVVDDRLPTKDGELLFVHSAEGSEFWSAL
LEKAYAKINGCYEALSGGATTEGFEDFTGGIAEWYELRKPPPNLFKIIQKALEKGSLLGC
SIDITSAADSEAVTYQKLVKGHAYSVTGAEEVESSGSLQKLIRIRNPWGQVEWTGKWNDN
CPSWNTVDPEVRANLTERQEDGEFWMSFSDFLRHYSRLEICNLTPDTLTCDSYKKWKLTK
MDGNWRRGSTAGGCRNYPNTFWMNPQYLIKLEEEDEDEEDGERGCTFLVGLIQKHRRRQR
KMGEDMHTIGFGIYEVPEELTGQTNIHLGKNFFLTTRARERSDTFINLREVLNRFKLPPG
EYVLVPSTFEPHKDGDFCIRVFSEKKADYQAVDDEIEANIEEIDANEEDIDDGFRRLFVQ
LAGEDAEISAFELQTILRRVLAKRQDIKSDGFSIETCKIMVDMLDEDGSGKLGLKEFYIL
WTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKLPCQLHQVIVARFADDELIIDFD
NFVRCLVRLETLFKIFKQLDPENTGTIQLNLASWLSFSVL
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcatcgcgataaagctggccaaggaccgcgaagcggccgaggggctggggtcg
catgagagagccatcaagtacctcaaccaggactacgagacgctgcggaacgagtgcctg
gaggccggggcgctcttccaggatccttccttccccgccctgccgtcatccttgggctat
aaggagttggggccctactccagcaaaactcggggcatcgaatggaagcggcccacggag
atctgcgctgacccccagttcattattggaggagccacccgcacagacatctgccaagga
gccctgggggactgctggctgctggctgccatcgcctccctcaccttgaatgaggaaatc
ctggctcgggttgtgcctccagatcagagcttccaggaaaactatgcaggcatcttccac
ttccagttctggcaatatggcgagtgggtggaggtggtggtggacgacaggctgcccact
aaggacggggagctgctctttgtgcattcagctgaagggagtgagttctggagtgccctt
ctggagaaagcctatgccaagatcaatgggtgctatgaagcactctcagggggtgccacc
acggaaggctttgaagacttcacaggaggcattgctgagtggtatgagctgaggaagcct
cctcccaacttgttcaagatcatccagaaggctttggagaaaggttctctgcttggctgc
tctatcgatatcaccagcgctgcagattctgaggccgttacgtaccagaagttggtgaaa
ggacatgcgtactctgtcaccggagccgaggaggttgaaagttcaggaagcctgcagaaa
ttgatccgcatcaggaatccctggggacaagtagagtggaccgggaagtggaatgacaat
tgccccagctggaacacggttgacccagaagtaagggcaaatctaaccgaacggcaggag
gacggagaattctggatgtccttcagtgacttcctgagacactactctcgcctggagatc
tgcaacctgaccccggacaccctcacctgtgactcctataagaagtggaaactcaccaag
atggatgggaactggaggcgaggctccaccgcagggggctgcaggaattacccaaatacc
ttctggatgaaccctcagtacctaattaagctggaggaagaagacgaagatgaggaggat
ggggagagaggctgtaccttcctggtgggtctcatccagaagcaccggcgacggcagagg
aagatgggcgaggacatgcacaccattggcttcggcatctatgaggttccagaggagcta
acagggcagaccaacatccacctcggcaaaaactttttcctcacaacccgagccagggag
cggtcagataccttcattaacctccgcgaggtcctcaaccgcttcaagctgcccccggga
gagtatgtcctcgttccctccaccttcgaaccccacaaggatggcgatttctgcatccga
gtcttctcggagaagaaggctgactaccaagctgttgatgacgagatcgaggccaacatt
gaagagattgacgccaatgaggaggacattgacgatggattccgaaggctctttgttcag
ctggctggagaggatgcagagatctctgcctttgagctgcagaccatcttaagaagagtt
ctagccaaacgccaagacatcaagtcagacggcttcagcatcgagacctgtaagatcatg
gtggacatgctggatgaagatgggagtggcaagcttggcctgaaggagttctacatcctc
tggacgaagattcagaaataccaaaaaatctaccgggaaatcgatgtggacaggtctgga
accatgaattcctacgagatgcggaaagcactggaagaagcaggtttcaagctgccctgt
caacttcatcaagtcatcgttgcccggtttgcagacgacgagctaatcatcgactttgac
aattttgtgcggtgtttggtccgtctggaaacgctattcaagatattcaagcagctagac
cctgagaacactggaacgatacagctcaaccttgcttcgtggctgagtttttcagtactc
tga

DBGET integrated database retrieval system