KEGG   Mus musculus (mouse): 12350Help
Entry
12350             CDS       T01002                                 

Gene name
Car3, BB219044, Ca3, Car-3
Definition
(RefSeq) carbonic anhydrase 3 (EC:4.2.1.1)
  KO
K01672  
carbonic anhydrase [EC:4.2.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Nitrogen metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    12350 (Car3)
Enzymes [BR:mmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonate dehydratase
     12350 (Car3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
3 3.22 cM; 3 A2
AA seq 260 aa AA seqDB search
MAKEWGYASHNGPDHWHELYPIAKGDNQSPIELHTKDIKHDPSLQPWSASYDPGSAKTIL
NNGKTCRVVFDDTYDRSMLRGGPLSGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHL
VHWNPKYNTFGEALKQPDGIAVVGIFLKIGREKGEFQILLDALDKIKTKGKEAPFTHFDP
SCLFPACRDYWTYHGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLFSSAENEPPVPL
VGNWRPPQPVKGRVVRASFK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggagtggggctacgccagccacaatggtcctgatcactggcatgaactttat
ccaattgccaaaggggacaaccagtcacccattgaactgcatactaaagacatcaagcat
gacccctctctgcagccctggtcagcatcttatgaccctggctctgctaagaccatcctg
aacaatgggaagacctgcagagttgtgtttgatgatacttatgacaggtctatgctgagg
ggtggtcctctctctggaccctaccgacttcgccaattccatcttcactggggctcctct
gatgaccacggctctgagcacaccgtggacggagtaaaatacgctgctgagcttcacctg
gttcactggaatccaaagtataacacctttggagaggctctgaagcagcctgatggcatc
gctgtggttggcattttcctgaagataggacgggagaaaggcgagttccagattcttctt
gatgccctggacaaaattaagacgaagggcaaggaggccccttttacacactttgaccca
tcatgcctgttccctgcttgccgggactattggacctatcacggctccttcaccacgccg
ccctgcgaggagtgcattgtgtggctgctgctcaaagagcccatgactgtgagctcagac
cagatggccaagctgcgcagcctcttctccagcgcagagaatgagcccccggtgcctctg
gtggggaattggcgccctcctcagcctgtcaagggcagggtggtgagggcctccttcaag
taa

DBGET integrated database retrieval system