KEGG   Mus musculus (mouse): 12359Help
Entry
12359             CDS       T01002                                 

Gene name
Cat, 2210418N07, Cas-1, Cas1, Cs-1
Definition
(RefSeq) catalase
  KO
K03781  
catalase [EC:1.11.1.6]
Organism
mmu  Mus musculus (mouse)
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Carbon metabolism
FoxO signaling pathway
Peroxisome
Longevity regulating pathway
Longevity regulating pathway - multiple species
Amyotrophic lateral sclerosis (ALS)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    12359 (Cat)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    12359 (Cat)
  Amino acid metabolism
   00380 Tryptophan metabolism
    12359 (Cat)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    12359 (Cat)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    12359 (Cat)
 Organismal Systems
  Aging
   04211 Longevity regulating pathway - mammal
    12359 (Cat)
   04213 Longevity regulating pathway - multiple species
    12359 (Cat)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    12359 (Cat)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     12359 (Cat)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 E3; 2 54.43 cM
AA seq 527 aa AA seqDB search
MSDSRDPASDQMKQWKEQRASQRPDVLTTGGGNPIGDKLNIMTAGSRGPLLVQDVVFTDE
MAHFDRERIPERVVHAKGAGAFGYFEVTHDITRYSKAKVFEHIGKRTPIAVRFSTVTGES
GSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDAILFPSFIHSQKRNPQTHLKDPD
MVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNADGEAVYCKFHYKTDQ
GIKNLPVGEAGRLAQEDPDYGLRDLFNAIANGNYPSWTFYIQVMTFKEAETFPFNPFDLT
KVWPHKDYPLIPVGKLVLNKNPVNYFAEVEQMAFDPSNMPPGIEPSPDKMLQGRLFAYPD
THRHRLGPNYLQIPVNCPYRARVANYQRDGPMCMHDNQGGAPNYYPNSFSAPEQQRSALE
HSVQCAVDVKRFNSANEDNVTQVRTFYTKVLNEEERKRLCENIAGHLKDAQLFIQKKAVK
NFTDVHPDYGARIQALLDKYNAEKPKNAIHTYTQAGSHMAAKGKANL
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacagtcgggacccagccagcgaccagatgaagcagtggaaggagcagcgggcc
tcgcagagacctgatgtcctgaccaccggaggcgggaacccaataggagataaacttaat
atcatgaccgcggggtcccgagggcccctcctcgttcaggatgtggttttcactgacgag
atggcacactttgacagagagcggattcctgagagagtggtacacgcaaaaggagcaggt
gcttttggatactttgaggtcacccacgatatcaccagatactccaaggcaaaggtgttt
gagcatattggaaagaggacccctattgccgttcgattctccacagtcactggagagtca
ggctcagctgacacagttcgtgaccctcgggggtttgcagtgaaattttacactgaagat
ggtaactgggatcttgtgggaaacaacacccctattttcttcatcagggatgccatattg
tttccatcctttatccatagccagaagagaaacccacagactcacctgaaggatcctgac
atggtctgggacttctggagtcttcgtcccgagtctctccatcaggtttctttcttgttc
agtgaccgagggattcccgatggtcaccggcacatgaatggctatggatcacacaccttc
aagttggttaatgcagatggagaggcagtctattgcaagttccattacaagaccgaccag
ggcatcaaaaacttgcctgttggagaggcaggaaggcttgctcaggaagatccggattat
ggcctccgagatcttttcaatgccatcgccaatggcaattacccgtcctggacgttttac
atccaggtcatgacttttaaggaggcagaaactttcccatttaatccatttgatctgacc
aaggtttggcctcacaaggactaccctcttataccagttggcaaactggttttaaacaaa
aatccagttaattactttgctgaagttgaacagatggcttttgacccaagcaatatgccc
cctggcatcgagcccagccctgacaaaatgcttcagggccgcctttttgcctacccggac
actcaccgccaccgcctgggacccaactatctgcagatacctgtgaactgtccctaccgc
gctcgagtggccaactaccagcgtgatggccccatgtgcatgcatgacaaccagggtggt
gcccccaactattaccccaacagcttcagcgcaccagagcagcagcgctcagccctggag
cacagcgtccagtgcgctgtagatgtgaaacgcttcaacagtgctaatgaagacaatgtc
actcaggtgcggacattctacacaaaggtgttgaacgaggaggagaggaaacgcctgtgt
gagaacattgccggccacctgaaggacgctcagcttttcattcagaagaaagcggtcaag
aatttcactgacgtccaccctgactatggggcccgcatccaggctcttctggacaagtac
aacgctgagaagcctaagaacgcaattcacacctacacgcaggccggctctcacatggct
gcgaagggaaaagctaacctgtaa

DBGET integrated database retrieval system