KEGG   Mus musculus (mouse): 12361Help
Entry
12361             CDS       T01002                                 

Gene name
Cask, DXPri1, DXRib1, LIN-2, Pals3, mLin-2
Definition
(RefSeq) calcium/calmodulin-dependent serine protein kinase (MAGUK family) (EC:2.7.11.1)
  KO
K06103  
calcium/calmodulin-dependent serine protein kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Tight junction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Cellular community
   04530 Tight junction
    12361 (Cask)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     12361 (Cask)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CAMK group
  CASK family
   12361 (Cask)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    12361 (Cask)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
X A1.1; X 8.43 cM
AA seq 926 aa AA seqDB search
MADDDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLK
REASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASH
YMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGLVAGGRV
GTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPR
QWSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNA
RRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSGLLAAERAVSQVLDSLEEIHAL
TDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYP
ENNDAKELKRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDM
DMENVTRVRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREIN
GISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSTNNS
VSDLPSTTQPKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGK
LENSKNGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVF
DQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKK
DEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQ
ALKVLRTAEFAPFVVFIAAPTITPGLNEDESLQRLQKESDVLQRTYAHYFDLTIINNEID
ETIRHLEEAVELVCTAPQWVPVSWVY
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgacgacgtgctgttcgaggatgtgtacgagctatgcgaggtgatcggcaag
ggtcccttcagtgttgtacggcgatgtatcaacagagaaactgggcaacaatttgctgta
aaaattgttgatgtagccaagttcacatcaagtccagggttaagtacagaagatctaaag
cgggaagccagtatctgtcatatgctgaagcatccacacattgtagagctgttggagaca
tatagctcagatgggatgctttacatggtttttgaatttatggatggagcagatctgtgt
tttgaaatcgtaaagcgagctgatgctggttttgtatacagtgaagctgtagccagccac
tacatgagacagatactggaagctctgcgctactgtcatgataataacataattcacagg
gacgtgaagccccactgtgttctccttgcctcaaaagaaaactcggcacctgttaaactt
gggggctttggggtggccattcagttaggagaatctggacttgttgctggaggccgcgtt
ggaacacctcactttatggccccagaagtggtcaagagagagccttacggaaagcctgtg
gatgtctggggctgtggtgtgatccttttcatcctgctcagtggctgtttgcctttctac
ggaaccaaggaaagattgtttgaaggcattattaaaggaaaatataagatgaatccaagg
cagtggagccatatctctgaaagtgccaaagacctagtacgccgcatgctgatgctggat
cctgctgaaaggatcactgtttatgaagcactgaatcacccatggcttaaggagcgggat
cgttatgcctacaaaatccatcttccagaaacagtagaacaactgaggaaattcaatgca
aggagaaaactaaagggtgcagtactagctgctgtgtcaagtcacaaattcaattccttc
tatggggaccctcctgaagagttgccagatttctccgaagaccctacctcctcaggactt
ctagcagcagaaagagccgtctctcaggtgctggacagcctggaagagattcacgcactt
acagactgcagtgaaaaggacctagattttctacacagtgttttccaggatcaacatctt
cacacactgctggatctgtatgacaaaattaacacaaagtcttcgccacaaatcaggaat
cctccaagtgatgcagtacagagagccaaagaggtattggaagaaatttcatgttaccct
gagaataatgatgcgaaggaactaaagcgtattttaacacaacctcatttcatggcctta
cttcagactcatgatgtagtggcacatgaagtttacagtgatgaagcattaagggtcaca
cctcccccgacttccccctatttaaacggtgattctccagaaagtgcaaacggagacatg
gacatggagaatgtgaccagagttcggctggtacagttccaaaagaacacggatgagcca
atgggaatcactttgaaaatgaatgagctaaatcattgtattgtcgcaagaatcatgcat
gggggtatgattcacaggcaaggtacacttcatgttggtgatgaaatccgagaaatcaat
ggcatcagtgtcgctaaccaaacagtggaacagctacagaaaatgcttagggaaatgcga
gggagtattaccttcaagattgtgccaagctaccgcactcagtcttcgtcctgtgagaga
gattccccctccacttccagacagtcccctgctaatggtcatagcagcactaacaattct
gtttcggacttgccatcaaccacccaaccaaaaggacgacagatctatgtaagagcacaa
tttgaatatgatccagccaaggatgacctcatcccctgcaaagaagctggcatccggttc
cgagttggtgacatcatccagattattagtaaggatgaccacaactggtggcagggtaaa
ctggaaaactccaaaaatggaactgcaggtctcattccttctcctgaacttcaggaatgg
cgagtagcttgcattgccatggagaagaccaaacaagagcagcaggccagctgtacttgg
tttggcaagaaaaagaagcagtacaaagataaatatttggcaaagcacaacgcagtgttt
gatcaattagatcttgtcacatatgaagaagtagtcaaactgccagcattcaaaaggaaa
acattagtcttattaggtgcacatggtgttggaagaagacacataaaaaataccctcatc
acaaagcacccggaccggtttgcgtaccctattccacatacaaccagacctccaaagaaa
gatgaagaaaatggcaagaattattactttgtatctcatgaccaaatgatgcaagacatc
tcaaataacgaatacttggagtatggcagccatgaggatgcaatgtacgggacaaaactg
gagaccattcggaaaatccatgagcaggggctgattgcgattctggacgtggagcctcag
gcactgaaggtcctgaggactgcagagtttgctccttttgttgtcttcattgcggcgcca
actatcactccaggtttaaatgaggatgaatctcttcagcgcctgcagaaggagtccgat
gtcttgcagagaacatatgcacactacttcgatctcacaattatcaacaacgaaattgat
gagacaatcagacatctggaagaagctgtcgagcttgtgtgcacagccccacagtgggtc
ccagtctcctgggtctattag

DBGET integrated database retrieval system