KEGG   Mus musculus (mouse): 12368Help
Entry
12368             CDS       T01002                                 

Gene name
Casp6, CASP-6, Mch2
Definition
(RefSeq) caspase 6 (EC:3.4.22.59)
  KO
K04396  
caspase 6 [EC:3.4.22.59]
Organism
mmu  Mus musculus (mouse)
Pathway
Apoptosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    12368 (Casp6)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.59  caspase-6
     12368 (Casp6)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C14: caspase family
   12368 (Casp6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
3; 3 H1
AA seq 276 aa AA seqDB search
MTETDGFYKSREVFDPAEQYKMDHKRRGVALIFNHERFFWHLTLPERRGTNADRDNLTRR
FSDLGFEVKCFNDLRAEELLLKIHEVSTSSHIDADCFICVFLSHGEGNHVYAYDAKIEIQ
TLTGLFKGDKCQSLVGKPKIFIIQACRGSQHDVPVVPLDMVDHQTDKLDNVTQVDAASVY
TLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLARYGSSLEFTELLTLVNRKVSQ
RRVDFCKDPDAIGKKQVPCFASMLTKKLHFCPKPSK
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaccgatggcttctacaaaagtagggaagtgttcgatccagccgagcagtac
aagatggaccacaagaggagaggagttgccctcatcttcaatcacgagaggttcttttgg
cacctgaccctcccagagaggcggggcaccaacgcagacagagacaacctgactcgcagg
ttttcagatctaggatttgaagtgaaatgctttaacgacctcagagcagaagaactcctg
ctcaaaattcacgaggtgtcgacttcaagccacatagatgccgattgcttcatctgtgtc
ttcctgagccatggggaaggcaaccacgtttacgcatacgacgccaaaattgaaattcag
acgttgactggcttgttcaaaggagacaagtgtcagagcctggttggaaaacccaagata
tttatcatccaggcctgtcggggtagccagcatgacgtacccgtggttcccctggacatg
gtggatcaccagacagacaagctggacaacgtgacccaggtggatgctgcgtccgtgtac
acgctgccggcaggggcagacttcctcatgtgctactctgtcgcagaagggtattactct
caccgagaaactgtgaatggctcctggtacattcaggatttgtgtgagatgctggcgagg
tacggcagttccctggagttcacggagctgctcacgctggtgaacagaaaggtctctcag
cgccgcgtggacttctgcaaagacccggatgcaatcggcaagaagcaggtgccctgcttc
gcctcaatgctgaccaaaaagctgcatttctgtcccaaacctagcaagtag

DBGET integrated database retrieval system