KEGG   Mus musculus (mouse): 12369Help
Entry
12369             CDS       T01002                                 

Gene name
Casp7, AI314680, CMH-1, ICE-IAP3, Mch3, caspase-7, mCASP-7
Definition
(RefSeq) caspase 7 (EC:3.4.22.60)
  KO
K04397  
caspase 7 [EC:3.4.22.60]
Organism
mmu  Mus musculus (mouse)
Pathway
Apoptosis
Apoptosis - multiple species
TNF signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Pertussis
Legionellosis
Module
Apoptotic machinery
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    12369 (Casp7)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    12369 (Casp7)
   04215 Apoptosis - multiple species
    12369 (Casp7)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    12369 (Casp7)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    12369 (Casp7)
  Infectious diseases
   05133 Pertussis
    12369 (Casp7)
   05134 Legionellosis
    12369 (Casp7)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.60  caspase-7
     12369 (Casp7)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C14: caspase family
   12369 (Casp7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
19 D2; 19 51.84 cM
AA seq 303 aa AA seqDB search
MTDDQDCAAELEKVDSSSEDGVDAKPDRSSIISSILLKKKRNASAGPVRTGRDRVPTYLY
RMDFQKMGKCIIINNKNFDKATGMDVRNGTDKDAGALFKCFQNLGFEVTVHNDCSCAKMQ
DLLRKASEEDHSNSACFACVLLSHGEEDLIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKL
FFIQACRGTELDDGIQADSGPINDIDANPRNKIPVEADFLFAYSTVPGYYSWRNPGKGSW
FVQALCSILNEHGKDLEIMQILTRVNDRVARHFESQSDDPRFNEKKQIPCMVSMLTKELY
FSR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatgatcaggactgtgctgcggagctggaaaaggtggattcttccagcgaagac
ggagttgacgccaagccagaccgctcctctatcatctcctctattctcttgaagaagaag
agaaatgcctctgcgggccccgtcaggaccggccgggaccgagtgcccacttatctgtac
cgcatggatttccagaagatgggtaaatgcatcatcataaacaacaagaacttcgacaaa
gcgacaggtatggacgtccggaatgggacggacaaagatgcaggggccctcttcaagtgc
ttccaaaacctgggttttgaagtaaccgtccacaatgactgctcttgtgcaaagatgcaa
gatctgcttagaaaagcctctgaggaggaccacagcaactcggcctgcttcgcctgcgtc
ctgctgagccacggggaagaggacctgatttacgggaaagatggcgtgacacccataaag
gatctgacagctcattttaggggagaccgatgcaaaaccctgttagagaaacccaaactc
ttcttcattcaggcatgccgagggacggagctcgatgatggaatccaggctgactcgggg
cccatcaacgacattgacgctaatccccgcaacaagatcccggtggaagccgacttcctc
tttgcttactccacggttccaggttattactcatggaggaacccagggaaaggctcctgg
tttgtgcaggccctctgctccatcctgaatgagcatggcaaggacctcgagatcatgcag
atcctgaccagggtgaacgacagggtggccaggcacttcgagtcccagtctgatgatcca
cgcttcaacgagaagaagcagatcccgtgtatggtgtccatgctcaccaaagagctgtac
ttcagccgttga

DBGET integrated database retrieval system