KEGG   Mus musculus (mouse): 12370Help
Entry
12370             CDS       T01002                                 

Gene name
Casp8, CASP-8, FLICE, MACH, Mch5
Definition
(RefSeq) caspase 8 (EC:3.4.22.61)
  KO
K04398  
caspase 8 [EC:3.4.22.61]
Organism
mmu  Mus musculus (mouse)
Pathway
p53 signaling pathway
Apoptosis
Apoptosis - multiple species
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
TNF signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Huntington's disease
Legionellosis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Hepatitis B
Herpes simplex infection
Pathways in cancer
Viral carcinogenesis
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    12370 (Casp8)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    12370 (Casp8)
   04215 Apoptosis - multiple species
    12370 (Casp8)
   04115 p53 signaling pathway
    12370 (Casp8)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    12370 (Casp8)
   04621 NOD-like receptor signaling pathway
    12370 (Casp8)
   04622 RIG-I-like receptor signaling pathway
    12370 (Casp8)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    12370 (Casp8)
   05203 Viral carcinogenesis
    12370 (Casp8)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    12370 (Casp8)
   05016 Huntington's disease
    12370 (Casp8)
  Cardiovascular diseases
   05416 Viral myocarditis
    12370 (Casp8)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    12370 (Casp8)
  Infectious diseases
   05134 Legionellosis
    12370 (Casp8)
   05152 Tuberculosis
    12370 (Casp8)
   05161 Hepatitis B
    12370 (Casp8)
   05168 Herpes simplex infection
    12370 (Casp8)
   05145 Toxoplasmosis
    12370 (Casp8)
   05142 Chagas disease (American trypanosomiasis)
    12370 (Casp8)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     12370 (Casp8)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C14: caspase family
   12370 (Casp8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1 29.19 cM; 1 B
AA seq 480 aa AA seqDB search
MDFQSCLYAIAEELGSEDLAALKFLCLDYIPHKKQETIEDAQKLFLRLREKGMLEEGNLS
FLKELLFHISRWDLLVNFLDCNREEMVRELRDPDNAQISPYRVMLFKLSEEVSELELRSF
KFLLNNEIPKCKLEDDLSLLEIFVEMEKRTMLAENNLETLKSICDQVNKSLLGKIEDYER
SSTERRMSLEGREELPPSVLDEMSLKMAELCDSPREQDSESRTSDKVYQMKNKPRGYCLI
INNHDFSKAREDITQLRKMKDRKGTDCDKEALSKTFKELHFEIVSYDDCTANEIHEILEG
YQSADHKNKDCFICCILSHGDKGVVYGTDGKEASIYDLTSYFTGSKCPSLSGKPKIFFIQ
ACQGSNFQKGVPDEAGFEQQNHTLEVDSSSHKNYIPDEADFLLGMATVKNCVSYRDPVNG
TWYIQSLCQSLRERCPQGDDILSILTGVNYDVSNKDDRRNKGKQMPQPTFTLRKKLFFPP
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggatttccagagttgtctttatgctattgctgaagaactgggcagtgaagacctggct
gccctcaagttcctgtgcttggactacatcccacacaagaagcaggagaccatcgaggat
gcccagaagctatttctgaggctgcgggaaaaggggatgttggaggaaggcaatctgtct
ttcctgaaagagctgcttttccacatcagtcggtgggacctgctggtcaacttcctagac
tgcaaccgagaggagatggtgagagagctgcgggatccagacaatgcccagatttctccc
tacagggtcatgctctttaagctctcagaagaagtgagcgagttggaattgagatctttt
aagttccttttgaacaatgagatccccaaatgtaagctggaagatgacttgagcctgctt
gaaatttttgtagaaatggagaagaggaccatgctggcagaaaataacttggaaacccta
aaatcaatctgtgaccaggtcaacaagagcctgctggggaagatcgaggattatgaaaga
tcaagcacagagagaagaatgagccttgaaggaagggaagagttgccaccttcagttttg
gatgagatgagcctcaaaatggcggaactgtgtgactcgccaagagaacaagacagtgag
tcacggacttcagacaaagtttaccaaatgaagaacaaacctcggggatactgtctgatc
atcaacaatcatgatttcagcaaggcccgggaagacataacccaactccgaaaaatgaag
gacagaaaaggaacagactgtgataaagaggctctgagtaagacctttaaggagcttcat
tttgagatagtatcttacgacgactgcactgcaaatgaaatccacgagattctagaaggc
taccaaagcgcagaccacaagaacaaagactgcttcatctgctgtatcctatcccacggt
gacaagggtgtcgtctatggaacggatgggaaggaggcctccatctatgacctgacatct
tacttcactggttcaaagtgcccttccctgtctgggaaacccaagatctttttcattcag
gcttgccaaggaagtaacttccagaaaggagtgcctgatgaggcaggcttcgagcaacag
aaccacactttagaagtggattcatcatctcacaagaactatattccggatgaggcagac
tttctgctgggaatggctacggtgaagaactgcgtttcctaccgagatcctgtgaatgga
acctggtatattcagtcactttgccagagcctgagggaaagatgtcctcaaggagatgac
attcttagcatcctgactggcgtgaactatgacgtgagcaataaagacgacaggaggaac
aagggaaagcagatgccacagcccaccttcacactacggaagaagctcttcttccctccc
taa

DBGET integrated database retrieval system