KEGG   Mus musculus (mouse): 12371Help
Entry
12371             CDS       T01002                                 

Gene name
Casp9, AI115399, APAF-3, AW493809, CASP-9, Caspase-9, ICE-LAP6, Mch6
Definition
(RefSeq) caspase 9 (EC:3.4.22.62)
  KO
K04399  
caspase 9 [EC:3.4.22.62]
Organism
mmu  Mus musculus (mouse)
Pathway
p53 signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Apoptosis - multiple species
VEGF signaling pathway
Thyroid hormone signaling pathway
Alzheimer's disease
Parkinson's disease
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Legionellosis
Toxoplasmosis
Tuberculosis
Hepatitis B
Influenza A
Pathways in cancer
Colorectal cancer
Pancreatic cancer
Endometrial cancer
Prostate cancer
Small cell lung cancer
Non-small cell lung cancer
Viral myocarditis
Module
Apoptotic machinery
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    12371 (Casp9)
   04151 PI3K-Akt signaling pathway
    12371 (Casp9)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    12371 (Casp9)
   04215 Apoptosis - multiple species
    12371 (Casp9)
   04115 p53 signaling pathway
    12371 (Casp9)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    12371 (Casp9)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    12371 (Casp9)
   05210 Colorectal cancer
    12371 (Casp9)
   05212 Pancreatic cancer
    12371 (Casp9)
   05215 Prostate cancer
    12371 (Casp9)
   05213 Endometrial cancer
    12371 (Casp9)
   05222 Small cell lung cancer
    12371 (Casp9)
   05223 Non-small cell lung cancer
    12371 (Casp9)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    12371 (Casp9)
   05012 Parkinson's disease
    12371 (Casp9)
   05014 Amyotrophic lateral sclerosis (ALS)
    12371 (Casp9)
   05016 Huntington's disease
    12371 (Casp9)
  Cardiovascular diseases
   05416 Viral myocarditis
    12371 (Casp9)
  Infectious diseases
   05134 Legionellosis
    12371 (Casp9)
   05152 Tuberculosis
    12371 (Casp9)
   05164 Influenza A
    12371 (Casp9)
   05161 Hepatitis B
    12371 (Casp9)
   05145 Toxoplasmosis
    12371 (Casp9)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     12371 (Casp9)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     12371 (Casp9)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C14: caspase family
   12371 (Casp9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4; 4 E1
AA seq 454 aa AA seqDB search
MDEADRQLLRRCRVRLVSELQVAELWDALLSRELFTRDMIEDIQQAGSGSRRDQARQLVT
DLETRGRQALPLFISCLEDTGQGTLASLLQSGRQAAKQDPEAVKPLDHLVPVVLGPMGLT
AKEQRVVKLDPSQPAVGNLTPVVLGPEELWPARLKPEVLRPETPRPVDIGSGGAHDVCVP
GKIRGHADMAYTLDSDPCGHCLIINNVNFCPSSGLGTRTGSNLDRDKLEHRFRWLRFMVE
VKNDLTAKKMVTALMEMAHRNHRALDCFVVVILSHGCQASHLQFPGAVYGTDGCSVSIEK
IVNIFNGSGCPSLGGKPKLFFIQACGGEQKDHGFEVACTSSQGRTLDSDSEPDAVPYQEG
PRPLDQLDAVSSLPTPSDILVSYSTFPGFVSWRDKKSGSWYIETLDGILEQWARSEDLQS
LLLRVANAVSAKGTYKQIPGCFNFLRKKLFFKTS
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggacgaggcggaccggcagctcctgcggcgatgcagggtgcgcctagtgagcgagctg
caagtcgcggagctctgggacgctctgctgagtcgagagctcttcacgcgcgacatgatc
gaggatattcagcaggcaggatctgggtctcggcgggatcaggccaggcagctggtcaca
gaccttgagacccgagggaggcaggcccttcctctcttcatctcctgcttagaggacaca
ggccaaggcaccctggcttcactcttgcaaagcggtcggcaagcagccaagcaggatcca
gaggctgttaaacccctagaccacctggtgcctgtggtcctgggaccaatgggactcaca
gcaaaggagcagagagtagtgaagctggacccgtcacagcctgccgtgggaaacctcacc
ccagtggtgctggggccagaagagctctggcctgctcggctcaagccagaggttctcaga
ccagaaacacccaggcccgtggacattggttctggcggagctcatgatgtctgtgttcca
gggaagatcaggggacatgcagatatggcatacaccctggattcggatccctgtggccac
tgcctcatcatcaacaatgtgaacttctgcccttcctcggggctcggcacacgcacgggc
tccaacttggaccgtgacaaacttgagcaccgattccgctggctgcgcttcatggtggag
gtgaagaacgacctgactgccaagaaaatggtcacggctttgatggagatggcacaccgg
aaccaccgtgccctggactgctttgtggtggtcatcctctctcatggctgccaggccagc
cacctccagttcccgggtgctgtctatgggacagatggatgctccgtgtccattgagaaa
attgtgaatatcttcaacgggagcggctgccccagcctgggagggaagcccaagctcttc
ttcatccaggcctgcggtggtgagcagaaagaccatggctttgaggtggcctgcacttcc
tctcaaggcaggaccttggacagtgactctgagccagatgctgtcccctatcaggaaggc
ccaaggcccttggaccagctggatgctgtgtcaagtttgcctacccccagtgacatcctt
gtgtcctactccaccttcccaggttttgtctcctggagggacaagaaaagtggctcctgg
tacatcgagaccttggatggcattctggagcagtgggctcgctctgaagacctgcagtcc
ctccttctcagggttgccaatgctgtttctgcgaaagggacttacaagcagattcctggc
tgttttaacttcctccggaaaaagctgttttttaaaacttcatga

DBGET integrated database retrieval system