KEGG   Mus musculus (mouse): 12374Help
Entry
12374             CDS       T01002                                 

Gene name
Casr, CaR, Gprc2a
Definition
(RefSeq) calcium-sensing receptor
  KO
K04612  
calcium-sensing receptor
Organism
mmu  Mus musculus (mouse)
Brite
G protein-coupled receptors [BR:mmu04030]
 Class C. Metabotropic glutamate receptor family
  Calcium-sensing
   Extracellular calcium-sensing
    12374 (Casr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
16 B3; 16 25.57 cM
AA seq 1079 aa AA seqDB search
MAWFGYCLALLALTWHSSAYGPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVEC
IRYNFRGFRWLQAMIFAIEEINSSPALLPNMTLGYRIFDTCNTVSKALEATLSFVAQNKI
DSLNLDEFCNCSEHIPSTIAVVGATGSGVSTAVANLLGLFYIPQVSYASSSRLLSNKNQF
KSFLRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDICIDFS
ELISQYSDEEEIQQVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGRIWLASEAWA
SSSLIAMPEYFHVVGGTIGFGLKAGQIPGFREFLQKVHPRKSVHNGFAKEFWEETFNCHL
QDGAKGPLPVDTFVRSHEEGGNRLLNSSTAFRPLCTGDENINSVETPYMDYEHLRISYNV
YLAVYSIAHALQDIYTCLPGRGLFTNGSCADIKKVEAWQVLKHLRHLNFTNNMGEQVTFD
ECGDLVGNYSIINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEGKILWSGFSREVPFS
NCSRDCQAGTRKGIIEGEPTCCFECVECPDGEYSGETDASACDKCPDDFWSNENHTSCIA
KEIEFLAWTEPFGIALTLFAVLGIFLTAFVLGVFIKFRNTPIVKATNRELSYLLLFSLLC
CFSSSLFFIGEPQDWTCRLRQPAFGISFVLCISCILVKTNRVLLVFEAKIPTSFHRKWWG
LNLQFLLVFLCTFMQIVICIIWLYTAPPSSYRNHELEDEIIFITCHEGSLMALGSLIGYT
CLLAAICFFFAFKSRKLPENFNEAKFITFSMLIFFIVWISFIPAYASTYGKFVSAVEVIA
ILAASFGLLACIFFNKVYIILFKPSRNTIEEVRSSTAAHAFKVAARATLRRPNISRKRSS
SLGGSTGSIPSSSISSKSNSEDRFPQPERQKQQQPLALTQQEQQQQPLTLQPQQQQQPQQ
PRCKQKVIFGSGTVTFSLSFDEPQKNAMAHRNSMRQNSLEAQKSNDTLNRHQALLPLQCA
EADSEMTIQETGLQGPMVGDHQPEIESPDEMSPALVMSTSRSFVISGGGSSVTENILHS
NT seq 3240 nt NT seq  +upstreamnt  +downstreamnt
atggcatggtttggctactgtttggccctcctggctctcacctggcactcctctgcctat
gggcctgaccagcgagcccaaaagaagggggacattatcctaggaggtctctttcctatc
cattttggagtagcagccaaagatcaagatctgaagtcaagaccagagtctgtggagtgc
atcaggtataacttccgtggattccgatggttacaagccatgatctttgccatagaggag
ataaacagcagccccgcccttcttcccaacatgactctgggatataggatattcgacacc
tgtaacaccgtctccaaggctctggaggccaccttgagttttgttgcccagaacaaaatc
gattctctgaacctggatgagttctgcaactgctccgagcacatcccttcaaccatcgca
gtggtgggagcaaccggctccggtgtctccacagcggtagccaacctgctgggacttttc
tatatcccccaggtgagctacgcctcctctagcaggcttctcagcaataagaaccagttc
aagtccttcctccgcaccattcccaacgacgaacaccaggccaccgcgatggctgacatt
atcgagtatttccgttggaactgggtgggcacaattgcagccgacgacgactatggcagg
cctggcattgagaagttccgagaggaagccgaggagagggacatctgcattgacttcagc
gagctcatctcccagtactctgatgaggaagagatccagcaggtggtggaagtgatccag
aactctacagccaaggtcattgtcgttttctccagcggcccagacctagaacctctcatc
aaggagattgtgcgccgtaacatcacaggcaggatctggctggccagcgaggcctgggcc
agttcctccctgattgctatgcctgagtacttccatgtagtcgggggtaccattgggttc
ggtctgaaggctgggcagattccaggcttccgagaattcctacagaaagtccatcccagg
aagtctgtccacaatggttttgccaaagagttttgggaagaaacatttaattgccacctg
caagacggcgcaaaaggacctttacccgtggacaccttcgtgagaagtcacgaggaaggc
ggcaacaggttactcaatagctccactgccttccgacccctctgcacgggggatgaaaac
atcaatagtgtcgagaccccttacatggactacgaacatttacggatatcctacaacgtg
tacttagccgtctactccattgcgcacgccctgcaagatatatacacctgcttacccgga
agagggcttttcaccaacgggtcctgtgcagacatcaagaaggttgaggcctggcaggtc
ctgaaacacctacggcacctgaatttcaccaacaacatgggggagcaggtgaccttcgat
gagtgcggtgacctggtggggaactactccatcatcaactggcacctctccccagaggac
ggctccattgtgttcaaggaagttgggtactacaatgtgtatgccaagaagggagaaaga
ctgttcatcaatgaggggaagatcttgtggagtgggttctccagagaggtgcccttctcc
aactgcagccgggactgtcaggcagggaccaggaagggcatcattgagggagagcccacc
tgctgttttgagtgtgtggagtgtcctgacggcgagtacagtggtgagacagatgcgagt
gcctgtgacaagtgcccggatgacttctggtccaatgagaaccacacttcctgcattgcc
aaggagattgagttcctggcgtggactgagccctttggaatcgctctcactctctttgcg
gtgctgggcattttcctgaccgcctttgtgctgggcgtcttcatcaagttccgaaacacg
cccattgtcaaggccaccaaccgagagctgtcctacctcctgctcttctcactcctctgc
tgcttctccagctccctgttcttcattggggagccccaggactggacctgccgcctgcga
cagcccgccttcggcatcagcttcgtgctttgtatctcgtgcatcttggtgaagaccaat
cgagtcctcctggtatttgaggccaaaatacccaccagcttccaccggaagtggtgggga
ctcaacctgcagttcctgctggttttcctctgcaccttcatgcagattgtcatctgcatc
atctggctctacacggcacccccctccagctaccgcaaccacgagctggaagacgaaatc
atcttcatcacgtgccatgagggctcactcatggcgctcggctccctgatcggctacacc
tgcctcctggctgccatctgcttcttctttgccttcaagtctcggaagctgccagagaac
ttcaacgaagccaagttcattaccttcagcatgctcatcttcttcatcgtctggatctcc
ttcattccagcctatgccagcacctacggcaagtttgtctctgccgtggaggtgatcgcc
atcctggcagccagctttggcttgctagcctgcatcttcttcaacaaggtctacatcatc
ctcttcaagccttcacggaacaccatcgaggaggtgcgctccagcactgcggctcatgct
ttcaaagtggcagcccgcgccactctacgccgccccaacatctcccggaagcggtccagc
agcctcggaggctccactgggtcgattccctcctcctccatcagcagcaaaagcaacagc
gaagaccggttcccacagccggagaggcagaagcaacagcaaccactggccctgacccag
caagaacagcagcagcagcccctgactctccagccgcagcaacagcaacagccacagcag
ccgagatgcaaacagaaggtcatcttcggcagtggcacagtcaccttctctctgagcttt
gatgagcctcagaagaatgctatggcccacaggaactccatgcgccagaactccctggag
gcccagaagagcaatgacactttgaacagacaccaggccctgcttcccctacagtgtgca
gaggcggactcagaaatgaccattcaggagacgggcttgcaagggccaatggtgggggac
caccagccagaaatagaaagcccagatgaaatgtccccagctctggtcatgtccacctct
cggagcttcgtcatcagcggtggaggtagctctgtgacggaaaacatactgcactcctaa

DBGET integrated database retrieval system