KEGG   Mus musculus (mouse): 12380Help
Entry
12380             CDS       T01002                                 

Gene name
Cast
Definition
(RefSeq) calpastatin
  KO
K04281  
calpastatin
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
13; 13 C1
AA seq 788 aa AA seqDB search
MSQPGPKPAASPRPSRGAAARHTQEHVNEKNIGSSSKPGEKKGSDEKKAASLGSSQPSRP
HVGEAATATKVTASSAATSKSPSMSTTETKAIPVNKQLEGPDQKRPREQAVKTESKKPQS
SEQPVVHEKKSKGGPKEGSEPKNLPKHTSSTGSKHAHKEKALSRSNEQMVSEKPSESKTK
FQDVPSAGGESVAGGGTVATALDKVVGKKKEQKPFTPASPVQSTPSKPSDKSGMDAALDD
LIDTLGGHEDTNRDDPPYTGPVVLDPMYSTYLEALGIKEGTIPPEYRKLLEKNEGITQPL
PDSPKPMGTDQAIDALSSDFTCSSPTGKQSEKEKSTGEIFKAQSAGVTRSSVPPKEKKRK
VEEEVINDQALQALSDSLGTRQPDPPSHVSQAEQVKEAKAKEERQEKCGEDEDTVPAEYR
LKPAKDKDGKPLLPEPEETSKSLSESELIGELSADFDRSTYQDKPSTPAEKKSNDTSQTP
PGETVPRASMCSIRSAPPKLASLKGVVPEDAVETLAGSLGTREADPEHEKTVEDKVKEKA
KEEEHEKLGEKEETVPPDYRLEEVKDKDGKPLLPKESQEQLAPLSDDFLLDALSQDFSSP
ANISSLEFEDAKLSAAISEVVSQTPAPSTHAAAPLPGTEQKDKELDDALDELSDSLGQRP
PDPDENKPLDDKVKEKIKPEHSEKLGERDDTIPPEYRHLLDNDGKDKPEKPPTKKTEKPD
QDRDPIDALSEDLDSCPSTTETSKNTAKGKSKKTSSSKASKDGEKTKDSSKKTEEVSKPK
AKEDARHS
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagcccggcccgaagcctgccgcctctcccaggcccagtcgcggcgcggcagct
cgccacacccaggagcatgttaatgaaaagaatattggatcatcttctaaaccaggagaa
aagaaaggatccgatgagaaaaaagcagcaagtttggggagcagtcagccttccagacca
catgttggtgaagctgccacagccaccaaggtgacagcttcctctgctgccaccagcaag
tcccccagcatgagtaccacagagactaaggcaattccagtaaacaaacagttggaagga
cctgaccagaaaagacccagagaacaggctgtgaaaacagagtctaagaaaccacaatca
agtgagcaacctgtggttcacgagaaaaagtcaaaaggagggccaaaggaagggtcagag
cccaaaaatcttccgaagcacacatcaagtacaggaagcaagcatgctcataaagaaaaa
gcactttccagatcaaatgaacagatggtgtcagagaaaccatcagaatcaaagacaaaa
tttcaagatgttccttcagctggtggagagagtgtggctggaggtgggactgtggccact
gccttggacaaagtggttggtaagaaaaaagaacagaaaccattcacaccagcttcacct
gtgcagtccacaccgagcaagccatctgacaagtcaggcatggatgctgccttggatgac
ctgatagacaccttaggtggacatgaagatactaacagagatgatccaccatatactgga
ccagtagttttggacccaatgtattctacctaccttgaggcactgggtataaaagaaggg
actattcctccagagtataggaaacttttggaaaaaaatgaagggatcacacaacctctt
ccagactctcctaaacctatggggactgaccaggctatagatgccttgtcatctgatttc
acctgtagttctccaactggaaagcaaagtgagaaagagaagtctactggggaaattttc
aaagctcagtctgcaggagtgaccagaagttctgttccccccaaggagaagaaaaggaag
gtggaagaggaggtcataaatgatcaagcacttcaggctctgtcagattcactgggcacc
cggcagccagatcctccgagccacgttagccaagctgaacaagtcaaagaggcaaaagca
aaagaagaaaggcaggagaagtgtggtgaagatgaggacacagtcccagctgagtacagg
ttaaaaccagcaaaggataaagatggaaaaccactattgccagagcctgaagaaacatct
aagagcctgagtgagtcggagctgattggggagctttcagcagattttgaccgatctaca
tatcaagacaaaccatctacgccagctgaaaagaaatccaatgacacatcccaaactcct
ccgggggagactgtgcctcgggcctccatgtgcagtatacggtcagcgccacccaaacta
gcatccttgaagggcgtggtaccagaagatgctgttgaaaccttggctggaagcctgggg
acaagggaagcagatccagaacatgaaaaaactgtggaggataaagtcaaggagaaagct
aaagaagaagagcatgaaaaacttggtgaaaaagaagaaacagtgcctcctgattatcga
ctagaagaagtcaaggataaggatggaaaaccactcctgcccaaagaatcccaggaacaa
cttgcacccttaagcgatgacttccttcttgatgccttgtctcaggacttctccagtccg
gcaaacatatcgtctcttgaatttgaagatgccaaactttctgctgccatttctgaagta
gtttctcagacacctgctccaagcacccatgcagcagctccactgcctggcactgagcag
aaagacaaagaacttgatgatgccttggatgaactttctgacagtcttggacaaaggccg
cctgatccagatgagaacaaaccactggatgacaaagtgaaggagaaaatcaaaccagag
catagcgagaaactgggagaaagagacgacaccatcccccctgaatacaggcatctcttg
gataatgatgggaaggacaaaccagagaagccaccgactaagaaaacagagaaacctgat
caggaccgggaccccattgatgccctctcagaagatttggatagctgcccctcaactaca
gagacctcaaagaatacagcaaaggggaagagcaagaagacttcaagttccaaagcatcc
aaggacggagagaaaacaaaggactcttccaagaagacagaggaagtgtccaagccaaag
gctaaagaagatgcaagacacagttaa

DBGET integrated database retrieval system